KEGG   Cellulophaga lytica HI1: IX49_03750Help
Entry
IX49_03750        CDS       T03279                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00564  Glycerophospholipid metabolism
clh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IX49_03750
Enzymes [BR:clh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IX49_03750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like FAD_binding_3 NAD_binding_8 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIM59675
LinkDB All DBs
Position
858423..860003
Genome map
AA seq 526 aa AA seqDB search
MTKNIFNREALIAQLQQEKNWDVLIIGGGASGLGAALDSATRGYKTVLFEQIDYAKGTSS
RSTKLVHGGVRYLAQGNVDLVREALHERGLLAKNAPHLVSNLSFIIPNYKWWGTPFYTIG
LKVYDILSGRLSFGKSFSLSRKKTIQKLKTIKTDGLKGGVLYHDGQFDDSRLAVNIAQTA
IEKGATLLNYFKVIKLTKDTNGNTNGVVVLDTETNTEYTVFAKTIINATGVFTDEILKMD
DATSKNLVRPSQGIHLVVDRSFLPGNEAIMIPKTTDGRVLFLVPWHNRVILGTTDTLIDS
HSLEPKPLEEEIDFILANANEYLNKNVSRKDVLSMYSGLRPLAAPKDKSEKTKEISRSHK
VLVSNSKLITITGGKWTTYRRMAQDTINKAIEVGQLAKKQCVTEDLQLHGAVANNDIINH
LSFYGSDEASILEMVQHDPSLGEKLHPNLEFVKAEVVWAVKNEMARTIEDILARRVRVLF
LDAKAAIEIAPLVADIIAKELNKDNAWKQNQIENFTKVAEVYVLKH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaaacatatttaacagagaagcattaatagcacaattacaacaggaaaaaaac
tgggatgtattaattattggtggtggtgcttctggtttaggagctgcactagatagtgct
actagagggtacaaaacagtattgtttgaacagatagattatgcaaaaggaactagtagc
cgtagtacaaaactagtacacggtggggtacgttatttggctcagggcaatgtagatttg
gtaagagaagctttacatgaaagaggattattagctaaaaatgcaccgcatttggttagc
aatctctcatttataattccaaattacaaatggtggggaactccgttttacaccattggc
ttaaaagtgtatgatattttatctggtagactaagttttggaaaatcgttttcactttct
agaaaaaaaactattcagaaattaaaaacaataaagacagacggactaaaaggtggtgtt
ttataccatgatggtcagtttgacgattctagacttgctgttaatatagcacaaacagct
attgaaaaaggcgcaacacttttaaattattttaaagttataaagcttacaaaagacact
aatggcaataccaatggtgtggtagttttagatacagaaacaaatacagagtatactgtt
tttgctaaaacaataataaatgctacaggtgtttttactgatgaaatattaaaaatggac
gatgctacttccaaaaaccttgtgcgtccaagtcaaggtattcacttagttgtagacagg
tcatttttaccaggtaatgaagccataatgataccaaaaactacagatggtagggtatta
tttttagtgccttggcacaacagagtaattttaggaacaacagacacccttatagacagc
catagtttagagcctaaacctttagaagaagaaatagattttatactagcaaatgccaac
gagtatttaaacaaaaatgttagtcgtaaagacgtattaagtatgtactctgggttacgt
cctttagctgcaccaaaagataaatctgaaaaaacaaaagaaatatctagaagtcataaa
gttttagtttctaactctaaattaattacaattactggcggtaaatggacaacctataga
agaatggcacaagacaccataaacaaagctatagaagtaggacagcttgccaaaaagcaa
tgtgttacagaagatcttcaattgcatggcgcggttgccaacaatgatataattaatcat
ttatccttttatgggtctgatgaagccagtattttagaaatggtacaacatgacccaagt
ttaggtgaaaaattgcatcctaatttagagtttgtaaaagccgaagtagtttgggcagtt
aaaaatgaaatggcaagaaccattgaagatattttagctaggcgtgtacgagtattattt
ttagacgccaaagccgcaatagaaatagcaccattagttgcagatattatagctaaggaa
ctaaataaagataatgcctggaaacaaaatcaaattgaaaactttacaaaagttgctgaa
gtttatgttttaaaacattaa

DBGET integrated database retrieval system