KEGG   Cellulophaga lytica HI1: IX49_03760Help
Entry
IX49_03760        CDS       T03279                                 

Definition
(GenBank) MIP (Major intrinsic protein) family permease
  KO
K02440  glycerol uptake facilitator protein
Organism
clh  Cellulophaga lytica HI1
Brite
KEGG Orthology (KO) [BR:clh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:clh02000]
    IX49_03760
Transporters [BR:clh02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    IX49_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP DS MASE1
Motif
Other DBs
NCBI-ProteinID: AIM59677
LinkDB All DBs
Position
861542..862270
Genome map
AA seq 242 aa AA seqDB search
MTPFIAEIIGSAILILLGGGVVANVVLNKTNGNNSGWIVITTGWALAVYVGVVIAGPYSG
AHLNPAVSIGLAIANKFEWYKVPMYVLAQFIGTMVGATFVWLTYKHHFNETEDKDAKKAV
FCTAPAIKNTFSNLFSEAIGTFVLLLTIFYFTDATLTEPNTIIGLGSVGAIPVAFLVWAI
GLSLGGTTGYAINPARDLGPRIIHALLPIKNKAKSDWSYAWIPVVGPILGASLAAFLMLA
LS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactccatttattgcagaaattattggtagtgccattctaattttacttggtggtggc
gtagttgcaaatgttgtattaaataaaactaatggtaataacagtggctggattgtgatt
accactggctgggcacttgctgtttatgtaggtgtggttatagctgggccttatagtggt
gctcatctaaaccctgctgttagtattggtttggctattgcaaacaaatttgaatggtat
aaagtacctatgtatgtacttgcgcaatttattggtactatggttggcgctacttttgtt
tggcttacatacaaacatcattttaatgaaacagaagataaagatgctaaaaaggctgtt
ttttgcactgctcctgccattaaaaatacatttagcaacttatttagtgaggccataggc
acttttgtgctgttacttactattttctattttacagatgctacactaacagagcctaat
actataattggactaggctcggttggcgctatacccgtagcatttttagtctgggcaatt
gggctctctttaggcggtactacaggttatgctattaaccctgctagagatttgggacct
agaattatacacgctttacttcctattaaaaataaagctaaaagtgattggagctatgct
tggatacctgtggtaggccctattttaggtgcttcactagcggcttttctaatgcttgct
ttaagctaa

DBGET integrated database retrieval system