KEGG   Cellulophaga lytica HI1: IX49_05520Help
Entry
IX49_05520        CDS       T03279                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00010  Glycolysis / Gluconeogenesis
clh00053  Ascorbate and aldarate metabolism
clh00071  Fatty acid degradation
clh00280  Valine, leucine and isoleucine degradation
clh00310  Lysine degradation
clh00330  Arginine and proline metabolism
clh00340  Histidine metabolism
clh00380  Tryptophan metabolism
clh00410  beta-Alanine metabolism
clh00561  Glycerolipid metabolism
clh00620  Pyruvate metabolism
clh00625  Chloroalkane and chloroalkene degradation
clh01100  Metabolic pathways
clh01110  Biosynthesis of secondary metabolites
clh01120  Microbial metabolism in diverse environments
clh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IX49_05520
   00053 Ascorbate and aldarate metabolism
    IX49_05520
   00620 Pyruvate metabolism
    IX49_05520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IX49_05520
   00561 Glycerolipid metabolism
    IX49_05520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX49_05520
   00310 Lysine degradation
    IX49_05520
   00330 Arginine and proline metabolism
    IX49_05520
   00340 Histidine metabolism
    IX49_05520
   00380 Tryptophan metabolism
    IX49_05520
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IX49_05520
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IX49_05520
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IX49_05520
Enzymes [BR:clh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     IX49_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIM60003
UniProt: A0A1L7EBH6
LinkDB All DBs
Position
1222444..1223997
Genome map
AA seq 517 aa AA seqDB search
MSEIAASFGIESALKELGLKDINEGTSTGSNNFSNGDIIESYSPVDGKLIGKVKATTKED
YNIVMQTATSAFKTWRTMPAPQRGEIVRQFGEKLREKKEALGKLVSYEMGKSYQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWAWNTAL
AWICGDVCVWKPSEKTPMCGVACQNIAAEVFAANNLPEGICNLINGDYKVGEMMTKDTRI
PLVSATGSTRMGKIVAKEVAGRLGKSLLELGGNNAIIVTPDADIKMTVIGAVFGAVGTAG
QRCTSTRRLIIHDSIYDKVKDAVISAYNQLRIGNPLDENNHVGPIIDKDAVKMYQDALDK
VVKEGGNIVVEGGVLEGEGYESGCYVKPAIAEAKNSFEIVQHETFAPILYLLKYSGGVEN
ALEMQNGVAQGLSSAIMTNNLREAEHFLSVQGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTINYTTELPLAQGIKFNL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatagcagcatcttttggaatagaaagcgccttaaaagaattgggccttaaa
gatattaatgaaggaacttctaccggttctaataatttctctaacggagacattatagaa
agttattccccagtagacggcaaacttattggtaaagtaaaagctaccacaaaagaagat
tacaatattgtaatgcaaactgctactagtgcttttaaaacctggaggacaatgccagct
ccacaacgtggagaaattgtacgtcagtttggagaaaaattaagagaaaaaaaagaagcg
cttggtaaacttgtatcttatgaaatgggaaaaagctaccaagaaggtttaggtgaagtt
caagaaatgatagatatatgcgactttgctgttggattatctagacaactacacggacta
acaatgcactctgagcgtccaggacatagaatgtatgagcaataccacccacttggcgta
gttggtattatatctgcatttaattttcctgttgctgtgtgggcttggaatactgcttta
gcttggatttgcggagatgtatgcgtttggaaacctagcgaaaaaacacctatgtgcggc
gtagcatgccaaaacattgctgcagaagtttttgctgctaataacttgccagaaggtatt
tgtaacttaataaatggcgattataaggttggtgaaatgatgactaaagacacccgtatt
cctctagtttctgccacaggatctacaagaatgggtaaaattgttgctaaagaggttgct
gggcgtttgggtaaatctttgttagaattaggcggtaacaacgccattattgttacacca
gatgcagatataaaaatgactgttattggcgctgtatttggtgctgttggtactgctggc
caacgttgcacatctacacgtaggttaattatacatgactctatttatgataaggtaaaa
gatgccgttattagtgcatacaatcagctgcgtattggtaatcctttagatgaaaataac
cacgttggaccaattatagataaagatgcagtaaaaatgtatcaagatgctttagacaaa
gttgttaaagaaggtggcaacattgtagtagaaggcggtgttttagaaggagaaggttat
gaaagtggttgctatgttaaaccagcaattgcagaagctaaaaactcttttgaaattgta
caacatgaaacgtttgctcctattttatacttattaaaatattctggtggtgtagaaaat
gcactagaaatgcaaaacggtgttgcacaaggcttgtcttctgcaattatgactaataat
ttacgagaagcagaacactttttatctgttcaaggatctgactgtggtattgctaatgta
aacattggtacctctggtgcagaaataggtggtgcttttggtggcgaaaaagaaactgga
ggaggacgagagtctggttcagatgcttggaaagtatatatgagaagacaaacaaatact
attaactatactacagaattaccactggcacaaggaattaaatttaacttgtaa

DBGET integrated database retrieval system