KEGG   Cellulophaga lytica HI1: IX49_05795Help
Entry
IX49_05795        CDS       T03279                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00240  Pyrimidine metabolism
clh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    IX49_05795
Enzymes [BR:clh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IX49_05795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AIM60057
UniProt: A0A1L7EBF3
LinkDB All DBs
Position
complement(1287213..1287857)
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPIVDTRYHEEM
VVSHDANEIRSTPVPAAANIRLLADGCDVVGIDEAQFFDDEIVTVCNDLANKGIRVLVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAICTRTGNLANYSFRKSNNDNLVMLGETEEYEP
LSRAAYYKAMLKEKVKTIDVDAEQIKDPKKDSNA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacggttaaccccaaagaacaatttggctggatagaggttatttgc
ggatctatgttctctggtaagacagaagaattaattagaagacttaaacgtgcgcagttt
gcaaagcaaaaagttgaaatttttaagcctattgtagatacgcgctaccatgaagaaatg
gtagtgtctcatgatgctaatgaaataaggtctacgcctgtgcctgctgctgcaaatata
cggttgttggcagatggttgtgatgttgtaggtatagatgaagctcagttttttgatgac
gaaattgttacagtttgtaatgatttagctaacaaaggcatacgtgtattggtagcaggt
ctagatatggactttaaaggaaatccatttgggccaatgccagccttaatggctacagcc
gagtatgtaactaaagtgcatgcaatttgtacacgtacgggtaacttagccaattatagt
tttagaaaatctaataatgataatttagtaatgctaggtgaaaccgaagagtatgagcca
ctaagtagagcagcatattacaaagcaatgcttaaagaaaaggtaaaaactatagacgta
gacgcagagcaaataaaagacccaaaaaaagatagtaatgcctaa

DBGET integrated database retrieval system