KEGG   Cellulophaga lytica HI1: IX49_08985Help
Entry
IX49_08985        CDS       T03279                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
clh  Cellulophaga lytica HI1
Pathway
clh00020  Citrate cycle (TCA cycle)
clh00310  Lysine degradation
clh00380  Tryptophan metabolism
clh01100  Metabolic pathways
clh01110  Biosynthesis of secondary metabolites
clh01120  Microbial metabolism in diverse environments
clh01130  Biosynthesis of antibiotics
clh01200  Carbon metabolism
Module
clh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IX49_08985
  Amino acid metabolism
   00310 Lysine degradation
    IX49_08985
   00380 Tryptophan metabolism
    IX49_08985
Enzymes [BR:clh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     IX49_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIM60647
LinkDB All DBs
Position
1994737..1997505
Genome map
AA seq 922 aa AA seqDB search
MDKYSFLNAAHTSFFATLYDKYLISPDSVEPSWRAFFQGFDFGQETAQEEFSENGPAIEA
AMPQSLQKEFKVIKLIDGYRSRGHLFTKTNPVRERRKYSPTLELDNFGLSSEDLNTVFTA
GEILGIGAVSLEEIIKHLKSIYCDAIGVEYMYIRKPERVEWIQNWLNVNDNHPKFNADRK
KHILKKLNQAVSFESFLHTKYVGQKRFSIEGNESLIPALDAVVERAAEMGVEQFVMGMAH
RGRLNVLTNIFGKAAKDIFSEFDGKDYEQEIFDGDVKYHLGWTSERKASNGNKIKMNIAP
NPSHLETVGAVVEGIARAKQDAHFPEDFSKVLPIVVHGDAAIAGQGLVYEVVQMANLDGY
KTNGTIHIVVNNQIGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVVHASLFALE
YRMRFNRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHNNSRDIYAERLLAEGVIEK
GFVKELENEYKASLEEELEDSRKEDKTVITPFMADEWSGFASVREWEMMEAVDTTYDKDK
LTEIAKVITELPSDKKFLRKVEKLVKDRKKMFFETNKLDWAMGELLAYGTLLQEGFGVRM
SGQDVERGTFSHRHAVMKVEESEEEIILLNHLSEEQARFQIYNSLLSEYGVVGFDYGYAM
ASPKTLTIWEAQFGDFSNGAQIMLDQYISAAEDKWKLQNGLVMLLPHGYEGQGAEHSSAR
MERYLQLCARDNMYIADVSTPAQMFHILRRQMKVNFRKPLVIFTPKSLLRHPKAVSTIDE
LANGTFQEVLDDTTADVSKVKSLVFCTGKFYYDLLAEKEEQNREDVALVRVEQLFPLPTE
KITEIIGRYTNADDIVWAQEEPRNMGAWSHIMMHYKDANKLRVASRRFYASPAAGSAVRS
KRRHQQVIDYVFDKTKDNMTKR
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcgtttttaaacgcagcgcatacatcattttttgcgactttatatgat
aaatacttaattagccctgacagtgtagagcctagctggcgtgccttttttcaaggtttt
gactttggtcaagaaacagcacaagaagagttttctgaaaacggaccggcaatagaagct
gcaatgccacagtctttacagaaagaatttaaagtaattaagttaattgatgggtacaga
agcagaggacacttgttcactaaaacaaacccagttcgcgaaagaagaaaatactcacca
actttagagttagacaattttgggttgtctagtgaagatttaaacaccgtttttactgca
ggagaaatcctaggtattggagctgtttctttagaggaaattataaaacatcttaaaagc
atatattgtgacgctattggcgttgagtatatgtacatacgtaagccagaaagagtagag
tggattcaaaattggttaaacgtaaatgacaatcaccctaagtttaacgcagatagaaaa
aagcatattcttaaaaaactaaatcaggcagtttcttttgagagttttttacatacaaaa
tatgttgggcaaaaacgtttttctatagagggtaatgagtctttaatccctgctttagat
gctgttgtagaacgagcagcagaaatgggagtagagcagtttgtaatgggtatggctcac
cgtggtagacttaacgtgcttactaatatttttggtaaagcagctaaggatatttttagt
gagtttgatggtaaagattacgagcaagaaatttttgatggcgatgttaagtatcactta
ggatggacatctgagcgtaaagctagtaacggaaataaaataaaaatgaatattgcacca
aatccatctcacttagagactgttggtgcggtagtagaaggtattgctagagctaaacaa
gatgctcacttccctgaagatttttcaaaagtattgccaattgttgtgcacggagatgct
gctattgcaggtcaaggtttagtgtatgaggttgtacaaatggcaaacttagatgggtat
aaaacaaatggtactatacatattgtagtaaacaaccaaattggttttacaacaaactat
ttagatgctaggtcatctacctattgtacagatgttgctaaagtaactttaagtccggta
ttacacgtaaatgcagatgatgcagaagctgtagtacacgcttctttatttgcattggag
tacagaatgcgttttaatagagatgtatttatagatttattaggttatagaaaatatggg
cacaatgaaggtgatgagcctcgttttacacagcctaaactatataaagcaatatctaaa
cacaataactcaagagatatttatgcagagcgtttacttgcagaaggagttatagaaaaa
ggatttgtaaaagaattagaaaatgaatacaaagcttctttagaagaagagttagaagat
tctagaaaagaagataaaacagttattacgccttttatggcagatgagtggagtggtttt
gcatctgttagagaatgggagatgatggaggctgtagatactacttatgataaagacaaa
ttaacagaaattgctaaggtgataacagaattacctagcgataaaaagtttttgcgtaaa
gttgaaaagttagttaaagatcgtaaaaaaatgttctttgaaactaacaaattagactgg
gcaatgggtgaacttttggcttacggtacgttgttacaagagggctttggtgttcgtatg
tctgggcaagatgtagaaagaggaactttttctcaccgtcatgcagttatgaaggttgaa
gaaagtgaagaagaaataatattattaaaccacttgtctgaggaacaagccagatttcaa
atttacaattcattgttgtctgaatatggtgttgttggttttgattatggttacgctatg
gctagcccaaaaacacttactatttgggaagctcaatttggagactttagtaatggagct
caaattatgttagatcagtacatttctgctgccgaagataaatggaagcttcaaaacgga
ttggtgatgttgttaccacacggttatgaaggtcagggtgcagagcattcttctgcacgt
atggaaaggtacttgcaattgtgtgcaagagataatatgtacattgcagatgtttctaca
cctgcacaaatgtttcatattctgcgtagacaaatgaaagttaattttagaaaaccttta
gtaatatttactcctaaaagtttattaagacatccaaaggcggtatctacaattgatgag
cttgctaacggaacttttcaggaggttttagatgatactacagcagatgttagtaaagtt
aaatctctagtattctgtactggtaagttttactatgacttgcttgccgaaaaagaggag
caaaacagagaagatgttgctttggtaagagtagaacaattatttccgttgccaacagaa
aaaataacagaaattattggtaggtatactaatgcagatgatattgtatgggcacaagaa
gaaccaagaaatatgggagcttggagtcatatcatgatgcattataaagatgccaataaa
ttaagagtagcgtctagacgtttttatgcctcaccagcagctggtagtgcagtacgttct
aagcgcagacaccaacaagtaatagattatgtctttgataaaaccaaagacaatatgaca
aaaagataa

DBGET integrated database retrieval system