KEGG   Chlorobium limicola: Clim_1098Help
Entry
Clim_1098         CDS       T00766                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cli  Chlorobium limicola
Brite
Enzymes [BR:cli01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Clim_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACD90167
UniProt: B3EC92
LinkDB All DBs
Position
complement(1201279..1201881)
Genome map
AA seq 200 aa AA seqDB search
MAYQQPALPYAENALEPHISAKTIGFHYGKHHAAYVNNFNNLVTGTPFDSMSIEEVICTT
AGDAQKIGVFNNGAQAWNHSFYWNCLSANGGGKPSGELAAKIDGDFGSFDKFVEELKAAA
ATQFGSGWAWLVLDNGTLKVVKTGNAQTPITSGQTPLLCVDVWEHAYYLDYQNRRPDYVA
ATIENLLNWKFAEENYQSAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagcaaccagcgctcccttacgcggaaaatgcgcttgagccgcatatttca
gcgaaaaccatcggattccattacggcaaacaccatgcggcatatgtgaacaatttcaat
aaccttgtaaccggaactccgttcgattcaatgagtatcgaggaggttatctgcacaacg
gccggcgatgctcagaaaatcggcgtattcaataacggcgcccaggcctggaaccactcc
ttctactggaactgcctctctgcaaacggcggcggaaaaccctcaggcgagctggcagcg
aaaatcgacggcgatttcggcagtttcgacaagtttgtcgaggaactgaaagccgccgca
gcgacccagttcggcagcggatgggcctggctggtgctcgataacggaacactgaaagtg
gtaaaaaccggaaatgcgcaaacccctattacctccggacagacaccattgctctgtgtc
gatgtgtgggaacacgcctactacctcgattaccagaacaggaggccggactatgtagcc
gcaactatcgaaaacctgctgaactggaagttcgcagaagagaactaccagtccgcaaaa
taa

DBGET integrated database retrieval system