KEGG   Clostridium ljungdahlii: CLJU_c12010Help
Entry
CLJU_c12010       CDS       T01276                                 

Gene name
alr1
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00473  D-Alanine metabolism
clj01100  Metabolic pathways
clj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLJU_c12010 (alr1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CLJU_c12010 (alr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:clj01011]
    CLJU_c12010 (alr1)
Enzymes [BR:clj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLJU_c12010 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:clj01011]
 Precursor biosynthesis
  Racemase
   CLJU_c12010 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADK14269
UniProt: D8GRD1
LinkDB All DBs
Position
1300512..1301672
Genome map
AA seq 386 aa AA seqDB search
MFRNYRPVWAEVNLDNLAYNMRNIKAQTMTKEIFGVVKADAYGHGALEVSKVLLENGATR
LSVAVLSEGIELRKGGITCPINILGVTPSTLFPDLIGYSLEPVVFSYEYAKSLSEYANSK
NKKVKVHLAVDSGMGRIGFLPTEHNVEEAVKISKISNIEIESVFSHFSTADEKDKKYSKF
QFDKYRWFVNELKEKGLNIKIRDISNSAAIVDLPETYCDGVRPGIILYGYYPSDEVDKSR
LDIKPVMTLKASVVYLKTLNEGQYVGYGRRFKTERRTVIATLPVGYADGYTRILSGKLKV
IINGKLAPVIGNICMDQCMIDVTDIEDVKIGDEVILMGSDGKVKFDAEDIAKLLGTISYE
VLCMVNKRVPRVYIKNGHVIKVKNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaattacagacctgtatgggcagaagtaaatttagataacctcgcatataat
atgagaaacataaaagcccaaacaatgacaaaagaaatttttggggtagttaaagcagat
gcgtatggacatggtgctttagaagtttcaaaagtactattggaaaatggagcaacaaga
ttatccgtagcagttttaagtgaaggtatagagctgagaaaaggaggaataacttgtcca
attaatattttaggtgttacaccatctacgttgtttcctgaccttattggatacagtttg
gaaccagtagtattttcatatgaatatgcaaaaagtttatctgaatatgcaaatagcaaa
aacaaaaaagtaaaagtacatcttgccgtagatagcggaatgggaagaatagggtttctt
ccaacagagcataatgtagaagaagcagtaaaaataagtaagatttccaatattgaaatt
gaaagtgttttttcacatttttctacagcagatgagaaagataaaaaatattcgaagttt
caatttgataaatataggtggtttgtcaatgagctaaaagaaaaaggtttaaatattaag
attagagatatttctaatagtgcagcaatagtagacttgccagagacttattgtgatgga
gtaagacctggaataatactctatggatattatccttcagatgaagtagacaagagtagg
ctggatattaagcctgttatgacactaaaggcaagcgttgtatacttaaaaactttaaat
gaaggtcagtatgtaggatatggaagaagatttaaaactgaacgaagaactgttatagct
actttgccagttgggtatgcagatgggtatactagaatcttatctggaaaattaaaagta
ataataaatggtaagcttgcaccagttataggcaatatttgtatggatcaatgtatgatt
gatgtcacagatattgaagatgtgaaaattggagatgaagtgatactgatgggcagtgat
ggaaaggtaaaatttgatgctgaggatatagcaaaacttttaggtacaataagctatgaa
gtactttgtatggtgaataagagagtcccaagggtatatataaaaaatggacacgttata
aaagtgaaaaactatatataa

DBGET integrated database retrieval system