KEGG   Clostridium ljungdahlii: CLJU_c12620Help
Entry
CLJU_c12620       CDS       T01276                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
clj  Clostridium ljungdahlii
Brite
KEGG Orthology (KO) [BR:clj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clj01001]
    CLJU_c12620
Enzymes [BR:clj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CLJU_c12620
Protein kinases [BR:clj01001]
 Serine/threonine kinases: Other
  Bacterial family
   CLJU_c12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH RIO1 Pkinase_fungal PBP1_TM Kdo Haspin_kinase FTA2
Motif
Other DBs
NCBI-ProteinID: ADK14330
UniProt: D8GRX7
LinkDB All DBs
Position
1362390..1364297
Genome map
AA seq 635 aa AA seqDB search
MIGTMLGNRYELLEKIGEGGMAIVYRAKDHLLSRNVAVKILKEEFSSDGEFVEKFKREAA
AAASLSDNNIVNIYDVGTQKDINYIVMECVIGKTLKQVIKEEKKIPPARAVEVAIQIAKA
LKCAHKNNIIHRDIKPHNILVTEDGIVKVTDFGIAKASDSVTITNSNKIMGSAHYFSPEQ
AKGSFVDFRTDIYSLGIVMYEMVTGRVPYDAESPVSIALKHIQEPVVPPNQLNENIPDSL
NRLILKAVEKEPIRRYQTMEDMLVDLKKIENNQKINLSDDDLSGDMTRIMDPVDVNNAYK
NEDDYDDEVEPARKPVKLNLDPKKKKRILTTAIGVLVVVIGIISGYIWYNKVYSSGDITV
PSIVGMKQDDAKQLVESKKLNFVIGGKEKSDKPEGTVIDCFPKSGTKVKSNSDVRVIISS
GSDSLTVPNLVGVDFATAKDIISNSGLTLGNVSYRHSDDVAEGDVISQDPTADSKAQNGT
KVNLVVSKGADAKYVTVPDVSGKNIEEAASIMAGSGLKVSRNPVATSDKSQSGVVTSQSI
GGSQQVKEGTTVSLTYYEYKETQNDQSSNLGTPTGGKSTGSSGQSKDGSDTGSGSGSSGS
KSDNGSGTGSSSSDGGTGNNGNTNTGGTGNSDKTN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatagggactatgctagggaatagatatgagttgcttgaaaaaataggagagggaggt
atggctattgtttatagggccaaagaccacctcttgagcagaaacgtagctgttaaaatt
ctcaaagaagaattttcaagtgatggagaatttgtagagaaatttaaaagggaagcagca
gcagcagcaagtctttcagataataatatagtgaacatatatgatgtaggtacacagaag
gatataaactacatagtaatggaatgtgttattggaaagactttaaaacaagtaataaaa
gaagaaaagaaaatacctcctgcaagggcagtagaagtagctattcaaatagctaaagct
ttgaaatgtgcccataagaataatattatacatagagatataaaacctcataatattctt
gtgacagaagatggtatagtaaaagtaacggactttggtatagccaaagcctcggattca
gttacaataactaattctaataagataatgggttctgcacactacttttccccagaacaa
gcaaaaggaagctttgtagactttagaacagatatttactcccttggcatagttatgtat
gaaatggttacaggacgtgttccctatgatgcagaaagtcctgtatcaatagcactaaaa
catatacaagaacctgtagttccaccaaatcagttaaatgaaaatataccagatagttta
aatagacttattctgaaagctgtggaaaaagagcctataagaagatatcagacaatggaa
gatatgttagtggatttgaaaaagatagaaaataatcaaaaaatcaatttgtcagatgat
gacttaagtggtgatatgactaggataatggatcctgtagatgtaaacaatgcttataaa
aatgaggacgattatgatgatgaagtagagccagcaagaaaaccagttaaattaaactta
gaccctaaaaagaaaaagagaatattgaccaccgcaataggtgttcttgtagttgtaata
ggtataatttcaggatatatttggtataacaaggtatatagcagcggagacataactgtg
ccgagtattgtaggcatgaaacaggatgatgccaaacagttagtagaaagcaaaaagctt
aattttgtaataggtggcaaagaaaaaagtgacaaaccagaaggaacagtaatagattgt
tttcctaaatcaggaacaaaggtaaaatcaaactcagatgtaagggtaattataagcagt
ggatctgattcactgactgttccaaatttggttggggtagattttgctactgcaaaggat
attatatcaaacagtgggcttactttgggaaatgtatcttacagacacagtgacgatgta
gcagaaggagatgttataagccaagatcctacagcagatagtaaagctcaaaatggtaca
aaagtaaatcttgtggtaagtaagggagcagatgcaaaatatgtaacagtaccagatgtt
tcaggcaaaaacatagaagaagcagcttctataatggcaggttcaggacttaaggtttct
agaaatccagtagctacttcagataaatctcagagtggagttgtaacaagccaaagcata
ggaggatcacagcaagttaaagaaggtactacggtaagcttaacttattatgaatataaa
gaaactcaaaatgatcaaagtagtaatttaggaaccccaactggaggaaaaagcactgga
agcagcggacaaagtaaggatggaagcgatacaggaagcggaagcgggtctagcggaagt
aaatctgataatggaagcggcacaggcagttcttcttctgatggaggtacaggaaacaat
ggaaatacaaatacgggtggtacaggaaattcagataaaacaaattag

DBGET integrated database retrieval system