KEGG   Clostridium ljungdahlii: CLJU_c20110Help
Entry
CLJU_c20110       CDS       T01276                                 

Definition
(GenBank) predicted tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00030  Pentose phosphate pathway
clj01100  Metabolic pathways
clj01120  Microbial metabolism in diverse environments
clj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLJU_c20110
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLJU_c20110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N DUF2291 DUF2275 HATPase_c_4
Motif
Other DBs
NCBI-ProteinID: ADK15073
UniProt: D8GIZ8
LinkDB All DBs
Position
2179645..2181468
Genome map
AA seq 607 aa AA seqDB search
MYGYDGKVLRINLKERTCKSENLDLDKAKKFIGCRGLGVKTLFDEIDPKIDALSPENKFI
IVTGPLTGAPVPTSGRFMVVTKAPLTGTIGISNSGGKWGVDLKKAGWDMIIVEDKADSPV
YIEIVDDKVEIKDASQLWGKVTSETTKELEKITENKSKVLCIGPAGERLSLMAAVMNDVD
RTAARGGVGAVMGSKNLKAITVKGTGKIALADKEKVKKVSVEKITTLKNDPVAGQGMPTY
GTAILVNIINENGVHPVKNFQESYTNQADKISGETLTANQLVRKNPCYSCPIGCGRWVRL
KDGTECGGPEYETLWCFGSDCGSYDLDAINEANMLCNEYGIDTITCGATIAAAMELYQRG
YIKDEEIAGDNLSLKWGDTESMIGWIKRMVYSEGFGAKMTNGSYRLCEGYGAPEYSMTVK
KQEIPAYDPRGIQGHGITYAVNNRGGCHIKGYMINPEILGYPEKLDRFALDGKAAYAKLF
HDLTAVIDSLGLCIFTTFGLGIQDYVDMYNAVVGESTYDADSLLEAGDRIWTLEKLFNLA
AGIDSSQDTLPKRLLEEPIPDGPSKGEVHRLDVLLPEYYSVRGWSKEGIPTEETLKKLGL
DEYIGKF
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttatgatggtaaagtattaagaattaatttaaaagaaagaacttgcaaatca
gaaaatttagatttagataaagctaaaaagtttataggttgtaggggactaggtgttaaa
actttatttgatgaaatagatcctaaaatagatgcattatcaccagaaaataaatttata
attgtaacaggtcctttaactggagctccggttccaactagtggaaggtttatggtagtt
actaaagcaccgcttacaggaactataggaatttcaaattcgggtggaaaatggggagta
gacttaaaaaaagctggttgggatatgataatagtagaggataaggctgattcaccagtt
tacattgaaatagtagatgataaggtagaaattaaagacgcgtcacagctttggggaaaa
gttacatcagaaactacaaaagagttagaaaagataactgagaataaatcaaaggtatta
tgtataggacctgctggtgaacgattgtctcttatggcagcagttatgaatgatgtagat
agaactgcagcaagaggcggcgttggtgcagttatgggatctaaaaacttaaaagctatt
acagttaaaggaactggaaaaatagctttagctgataaagaaaaagtaaaaaaagtgtcc
gtagaaaaaattacaacattaaaaaatgatccagtagctggtcagggaatgccaacttat
ggtacagctatactggttaatataataaatgaaaatggagttcatcctgtaaagaatttt
caagagtcttatacgaatcaagcagataaaataagtggagagactcttactgctaaccaa
ctagtaaggaaaaatccttgttacagctgtcctataggttgtggaagatgggttagacta
aaagatggcacagagtgcggaggaccagaatatgaaacactgtggtgttttggatctgac
tgtggttcatatgatttagatgctataaatgaagctaatatgttatgtaatgaatatggt
attgatactattacttgtggtgcaacaattgctgcagctatggaactttatcaaagagga
tatataaaagacgaagaaatagctggagataacctatctctcaagtggggtgatacggaa
tctatgattggctggataaagagaatggtatatagtgaaggctttggagcaaagatgaca
aatggttcatataggctttgtgaaggttatggagcaccggagtattctatgacagttaaa
aagcaggaaattccagcatatgatccaaggggaatacagggacacggtattacctatgca
gttaataatagaggaggctgtcatattaagggatatatgattaaccctgaaatattaggt
tatcctgaaaaacttgatagatttgcattagatggtaaagcagcttatgccaaattattt
catgatttaactgctgtaattgattctttaggattgtgcatattcactacatttgggctt
ggaatacaggattatgtagatatgtataatgcagtagtaggagaatctacttatgatgca
gattcactattagaggcaggagatagaatctggactcttgagaaattatttaatcttgca
gctggaatagacagcagccaggatactctaccaaagagattgttagaagaacctattcca
gatggcccatcaaagggagaagttcataggctagatgttcttctgccagaatattactca
gtacgaggatggagtaaagagggtatacctacagaagaaacattaaagaaattaggatta
gatgaatatataggtaagttctag

DBGET integrated database retrieval system