KEGG   Clostridium ljungdahlii: CLJU_c22800Help
Entry
CLJU_c22800       CDS       T01276                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00020  Citrate cycle (TCA cycle)
clj00190  Oxidative phosphorylation
clj00650  Butanoate metabolism
clj01100  Metabolic pathways
clj01110  Biosynthesis of secondary metabolites
clj01120  Microbial metabolism in diverse environments
clj01130  Biosynthesis of antibiotics
clj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLJU_c22800
   00650 Butanoate metabolism
    CLJU_c22800
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLJU_c22800
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CLJU_c22800
    1.3.5.4  fumarate reductase (quinol)
     CLJU_c22800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_oxidored GIDA Pyr_redox_3 Spo0A_C FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADK15338
UniProt: D8GKJ8
LinkDB All DBs
Position
complement(2500116..2501912)
Genome map
AA seq 598 aa AA seqDB search
MQIDKIIDTDILVVGGSGAGSMAAVTAARKGAKVLLAVKGKLGKSGNAIMAGAGFSMDGE
TAYYKYGLKEADPKNTKGKLFEQIVKQSFYLSDQNMVEQFVSDCDECCWELKQWIEKAGH
KVVFFGEEGYISSGKAVGVGCRYGVSKAGGIDVIEDFIAVDILMEDKKAVGAVGIEVYTG
KIIEIRSKSVILATGGYQPYSFKCTVSDMTGDGMAMAYRAGAKLADMEFLLYIPAVALSP
SVYKGSIYPFLHSSMLMPIVKNGKGESILDNIPENLLKMAKESEMGKLIFTYYYGDQIAR
GKGTPNGGVYFDYSNVPFDIYEKALKKAEPLMNIWYRKGFYQGNNLDTFVENIRKGIPWE
VGIGSEYSMGGIEVDENMYTGVPGLYAAGETTSGVFGAMRVADGLIEMLVQGYRAALSAC
KYIQNVNEPSMKNTNIDSIIKDIFSPLERKEGVSPIKIHRNIEKTADVGFNFRRNEEGLT
KALDEILKIHKYDISAMSTKSKNRVYNYEWIESVQARNLLTCTEAGVRAALMRKESRGTH
IRDDYEFVDNDNWLLRIMSSKGEDETMKLSTRKPKVTTMELPGGKNKNIPDYMLSMLK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatagataagataattgatactgacatattagttgttggaggttctggagcagga
tcaatggcagctgtaacagctgcgagaaaaggagcaaaagtactacttgcagtaaaaggg
aagcttggaaaaagcggaaatgccattatggcaggggcaggattttctatggatggagaa
acagcatattataaatatggactcaaggaagcagatcctaaaaatacaaagggaaaatta
tttgaacaaattgtaaaacagtctttttatttaagtgatcaaaatatggttgagcagttt
gtaagtgattgtgatgagtgctgctgggaacttaaacagtggattgaaaaagcaggacac
aaggttgtattttttggagaagaaggatatataagctcgggtaaagctgtgggagttggc
tgccgatatggagtttcaaaagcaggtggtattgatgttatagaagattttatagcagtg
gatattttaatggaagataaaaaagctgtaggtgcagtgggcatagaagtatatacagga
aaaattattgaaatcagatcaaagtcagttattttagctactggcggatatcagccttat
tcctttaaatgtactgtttccgatatgactggcgatggaatggctatggcataccgtgca
ggagccaagcttgcagatatggaatttttattatatataccagcagttgccctttcacca
tcagtatataaaggttcaatttatcccttcttacactccagtatgttaatgcctattgtt
aaaaatggtaagggagaatcaattttagataatatacctgaaaatttacttaaaatggcc
aaggaaagtgaaatgggaaagcttatatttacgtattattatggagatcaaattgcaaga
ggaaaaggaactccaaatggaggagtatattttgattattccaatgtaccttttgatatt
tatgaaaaagctttaaaaaaagctgaaccattaatgaacatatggtatagaaaaggattc
tatcaaggaaacaacttggatacttttgttgaaaatattagaaagggcattccatgggaa
gtaggtattggcagtgaatacagcatgggcggcattgaagtagacgaaaatatgtacact
ggagtaccaggactttatgcagctggtgagactacaagtggtgtatttggagctatgagg
gttgcagatggacttattgaaatgcttgtacagggttatagagcagcattgtccgcttgc
aaatatatacaaaatgtaaatgagccaagtatgaaaaataccaatattgatagtataatt
aaagatattttttcacctcttgaaagaaaagaaggagttagtcctataaaaatacacaga
aatatagaaaaaacggctgatgttggattcaactttagaagaaatgaagagggacttaca
aaagctttagatgaaattttaaaaatacacaaatatgacataagcgcaatgagtactaaa
agtaaaaatagagtttataactatgaatggatagaatcagtacaggctcgaaatctttta
acttgtacagaagcaggtgtaagagctgcccttatgagaaaggaaagtaggggtacacac
atacgtgatgattatgaatttgtagataatgataactggcttttaaggattatgagttcg
aaaggtgaagacgaaaccatgaaattatcaaccagaaagcctaaagtaacaacaatggaa
cttccaggtggtaaaaataagaatattcctgattatatgctttcaatgttaaagtaa

DBGET integrated database retrieval system