KEGG   Clostridium ljungdahlii: CLJU_c22820Help
Entry
CLJU_c22820       CDS       T01276                                 

Definition
(GenBank) hypothetical protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00020  Citrate cycle (TCA cycle)
clj00190  Oxidative phosphorylation
clj00650  Butanoate metabolism
clj01100  Metabolic pathways
clj01110  Biosynthesis of secondary metabolites
clj01120  Microbial metabolism in diverse environments
clj01130  Biosynthesis of antibiotics
clj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLJU_c22820
   00650 Butanoate metabolism
    CLJU_c22820
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLJU_c22820
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CLJU_c22820
    1.3.5.4  fumarate reductase (quinol)
     CLJU_c22820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 DHODB_Fe-S_bind Fer2
Motif
Other DBs
NCBI-ProteinID: ADK15340
UniProt: D8GKK0
LinkDB All DBs
Position
complement(2502521..2502847)
Genome map
AA seq 108 aa AA seqDB search
MKVKVYRFEPTVEEGEHYDCFDVPVIFEEKWTVMNVLDYIQEHCDSSLSYYKHSACGHGI
CGRCTLMVDGTPSLACTHVIEKGDEIVLEPLKGRKKVKDLVTISMNLT
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaagtatatcgatttgaaccaacagtagaagaaggtgaacattatgactgt
tttgatgttccagtaatttttgaagaaaagtggactgtaatgaatgttctcgattatatc
caggaacattgtgacagcagtttgagctattacaaacacagtgcctgtggccatggaatt
tgtggaagatgcactcttatggttgatggtactccttctcttgcatgcacacatgtaata
gagaagggcgatgaaattgtccttgagcctttaaaaggaagaaaaaaagtaaaagatttg
gttactatatcaatgaatcttacttag

DBGET integrated database retrieval system