KEGG   Capnocytophaga leadbetteri: CGC53_03740Help
Entry
CGC53_03740       CDS       T05313                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
clk  Capnocytophaga leadbetteri
Pathway
clk00240  Pyrimidine metabolism
clk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CGC53_03740
Enzymes [BR:clk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CGC53_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ATA81521
UniProt: A0A250F8T3
LinkDB All DBs
Position
876930..877535
Genome map
AA seq 201 aa AA seqDB search
MFLENNIHNHEEVGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPSFDTRYDDTN
IVSHNATEIPSTPVEAAASILLLADGCDVVGIDEAQFFDDEIVNVCNDLANRGVRVIVAG
LDMDYKGNPFGPMPYLMATAEYVTKVHAVCTRTGHLANYSFRKVPNDSQRMLGEAESYEP
LSRAAFIKARAKDEAQKTTNL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttcttagaaaacaacatacataatcacgaagaagtaggctggatagaggttatctgc
ggctcgatgttctcaggcaaaactgaagaactcatacgccgattgcgccgcgctcagttt
gctaagcaaaaagtagaaatatttaaaccctcttttgatacgcgttatgatgatactaac
atcgtatcgcacaacgctaccgaaatcccctctacccctgtagaggctgcagcgagcatt
ttactccttgctgacggctgcgatgtagtaggcatagacgaagctcagttttttgacgat
gagatagtaaatgtgtgcaatgatttggctaacagaggagtacgagtaatagtcgccgga
ctagatatggactacaaaggcaacccttttgggcctatgccctacctaatggcgacagct
gaatacgtcactaaggtacacgcagtctgcactcgcacagggcatttggctaactacagt
tttaggaaagtacctaacgatagtcagcgtatgttaggcgaagccgagagctacgaacca
ctaagccgagccgcctttataaaagcaagagccaaagacgaagctcaaaagacaactaac
ctctaa

DBGET integrated database retrieval system