KEGG   Campylobacter lari subsp. concheus LMG 11760: CONCH_1346Help
Entry
CONCH_1346        CDS       T03557                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acp] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cll  Campylobacter lari subsp. concheus LMG 11760
Pathway
cll00061  Fatty acid biosynthesis
cll00780  Biotin metabolism
cll01100  Metabolic pathways
cll01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CONCH_1346 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CONCH_1346 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cll01004]
    CONCH_1346 (fabZ)
Enzymes [BR:cll01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CONCH_1346 (fabZ)
Lipid biosynthesis proteins [BR:cll01004]
 Fatty acid synthase
  Component type
   CONCH_1346 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AJC89744
UniProt: A0A0A8H9Y6
LinkDB All DBs
Position
complement(1313916..1314356)
Genome map
AA seq 146 aa AA seqDB search
MIDVMQIQKILPHRYPFLLVDKIVELKNKEVVRGYKNISISDHVFMGHFPDHPIYPGVLI
LEGMAQTGGVLAFESMDDKVDPSTKVVYFTGIDNAKFRNPVRPGDRLDYEMSVVKNRGNM
WIFQGKAFVDGQLVAEAELKAMIVDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtaatgcaaattcaaaaaattttaccacataggtatccatttttacttgta
gataaaatcgtagaattaaaaaacaaagaagttgttagaggttataaaaatattagtata
agtgatcatgtctttatgggacattttccagatcatccaatttatccaggtgtgttaatt
ttagaaggcatggcacaaactggaggggttttagcatttgaaagtatggatgataaagta
gatccaagcaccaaagtagtatattttacgggtattgataatgcaaaatttagaaatcca
gtacgtccaggtgatagacttgattatgaaatgagtgtagtaaaaaatcgtggaaatatg
tggattttccaaggaaaagcttttgtagatggacaattagttgcagaagctgaacttaaa
gctatgatagtagataaatga

DBGET integrated database retrieval system