KEGG   Campylobacter lari RM16712: UPTC16712_0391Help
Entry
UPTC16712_0391    CDS       T03556                                 

Definition
(GenBank) putative membrane protein, TauE/SafE family permease
  KO
K07090  uncharacterized protein
Organism
clm  Campylobacter lari RM16712
Brite
KEGG Orthology (KO) [BR:clm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    UPTC16712_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AJD05934
UniProt: A0A0A8I6D0
LinkDB All DBs
Position
complement(368720..369472)
Genome map
AA seq 250 aa AA seqDB search
MELELTYYVILFFVAAFAGCVDAIVGGGGLITIPALFACGIPPHLALATNKLQSTFGSLT
AVLAYRKSMHIEKIALGILFTAIGAAIGTYAVLLIDQNAVKIIVLVCLILIFLYTIFKPD
LGHVHNKAKMSTTSFQITFGLLLGFYDGFLGPGTGSFWIFACVIFLGFSMKNASINTKIL
NFTSNVVALGVFLYSYEVLWKVGILMGIGQILGAFVGSKLVLKTQGTFIKKLFLTMVALT
IAKVAYDYLA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggagcttgaattaacttattatgtgattttattttttgttgctgcttttgcaggctgt
gttgatgcaattgtaggtggtggtggacttattaccatacctgctttatttgcttgtggt
attcctcctcatttagctctagccactaataagcttcaaagcacctttggctcactcacc
gcagttttagcttatagaaaatctatgcatatagagaaaatagctttaggaattttattt
actgctattggtgcagccattggaacttatgcggttttattaatagaccaaaatgctgtt
aaaatcattgtattggtttgccttattttgatctttttatatactattttcaaacctgat
ttaggtcatgtacataataaagctaaaatgagcaccacaagttttcaaatcacttttggt
ttattacttggcttttatgatggctttttagggcctggaactgggtctttttggattttt
gcttgtgtgatatttcttggttttagcatgaaaaacgcaagcattaatactaaaatctta
aattttactagcaatgtagtagctttaggggtatttttatactcttatgaggtgctttgg
aaagttggcattttaatgggtataggccaaattctaggcgcctttgtaggttcaaaacta
gttttaaaaacacaaggaacttttatcaaaaaactctttttaaccatggttgctttaact
atagctaaggttgcttatgattatcttgcttaa

DBGET integrated database retrieval system