KEGG   Mageeibacillus indolicus: HMPREF0868_0353Help
Entry
HMPREF0868_0353   CDS       T01181                                 

Definition
(GenBank) D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
clo  Mageeibacillus indolicus
Pathway
clo00473  D-Alanine metabolism
clo00550  Peptidoglycan biosynthesis
clo01100  Metabolic pathways
clo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:clo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF0868_0353
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0868_0353
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HMPREF0868_0353
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:clo01011]
    HMPREF0868_0353
Enzymes [BR:clo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HMPREF0868_0353
Peptidoglycan biosynthesis and degradation proteins [BR:clo01011]
 Precursor biosynthesis
  Amino acid ligase
   HMPREF0868_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADC91530
UniProt: D3R0I4
LinkDB All DBs
Position
complement(1474317..1475432)
Genome map
AA seq 371 aa AA seqDB search
MNTVAVIFGGVSTEHLVSCRSAFYVINALKELKYDVLPLGITKAGDWLPLLVEPEVLLTE
GWEQAAYKAWHKKHARGLKIKEVFNPRRFFTYFFGKNPEVIFPAVHGINCEDGTLQGFLN
MTDIPYVGSGVLASALGMNKIFAKQIWAANKLPVVPYYVVTRDDLAKDSIGLPETSAAVE
KVLTYPIFLKPASGGSSVGTFKAGNRSELVAALGEVSKFDREILLEQYIPARELEVAVLG
NLQPQAPMVGEILMQADVAFYDYETKYFAAGASSLALPADLPTDLAERILNLAQKAYKVL
GCKGMARVDFFLDRCSGALYLNEINSLPGFTATSLYPQAWAKAGINLPALVDQLCRLAIA
EHQAGRRVETI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagttgcagtaattttcggcggcgtttcaacggaacacttagtttcgtgtcgt
tccgctttttacgttatcaatgctttaaaagaacttaaatatgatgtgttgccgctgggc
attaccaaagcgggggattggttgccgttgctggtcgaaccggaggtgctacttacggag
ggttgggagcaggcggcttataaagcgtggcacaaaaagcacgcgcgaggcctgaaaatt
aaggaagtatttaatccgcggcgtttttttacctactttttcggcaaaaatcccgaggtg
attttcccggccgttcatggtatcaattgtgaagatggaacattacaaggatttttaaac
atgacagatattccttatgttggctccggcgtgttggcttcggctttaggcatgaacaaa
atttttgccaaacaaatttgggcggcaaataaattgccggtggtgccatattacgtggtt
actcgtgacgacttagctaaagacagcataggcttgccggaaacttccgccgccgtggaa
aaggttttgacctatccaatttttttgaaaccggcttcgggtggctcgtctgtcggtact
tttaaggcgggaaatcgttctgagttggttgccgcacttggtgaagtgagcaagtttgat
cgtgaaatccttttggagcaatatattccggcgcgagaacttgaagtcgcggttttgggt
aatttgcagccgcaagcgccgatggtcggcgaaattttgatgcaggcggacgtggctttt
tatgattatgagacgaaatattttgcggctggagcttcgtccttggccttgcctgcggat
ctcccgactgatttggcggagcgaattttaaatttggcacaaaaggcctacaaagtattg
ggttgtaagggaatggccagagtcgactttttcctcgaccgttgcagtggggcgttgtac
ttgaatgaaatcaattctttgcccggtttcacagctacaagtctgtatccgcaggcatgg
gcaaaagccgggataaatttgccggcgttggttgatcagctttgtcgtttggctattgcc
gagcatcaggccgggcggcgagttgaaactatctga

DBGET integrated database retrieval system