KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00561Help
Entry
CPK_ORF00561      CDS       T01859                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
clp  Chlamydia pneumoniae LPCoLN
Brite
Enzymes [BR:clp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPK_ORF00561 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: ACZ33031
LinkDB All DBs
Position
complement(772061..772684)
Genome map
AA seq 207 aa AA seqDB search
MSFVPYSLPELPYDYDALEPVISSEIMILHHQKHHQTYINNLNAALKRLDAAETQQNLNE
LIALEPALRFNGGGHINHSLFWETLAPIDQGGGQPPKHELLSLIERFWGTMDNFLKKLIE
VAAGVQGSGWAWLGFCPAKQELVLQATANQDPLEPLTGKLPLLGVDVWEHAYYLQYKNVR
MDYLKAFPQIINWGYIENRFSEIISSK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgttccttattctttaccagagttaccctatgattatgacgctttggagcct
gtaatttcttctgaaattatgattttacaccaccaaaagcatcatcagacctacattaat
aatcttaacgcggctttgaagagattagatgctgcagaaacacaacaaaaccttaatgaa
ctcattgctttagaacccgctctccgctttaacgggggaggacacatcaaccactctcta
ttctgggaaactcttgctcctatcgatcaagggggaggacagcctccaaaacatgagctc
ctttctcttattgaaagattttggggtacgatggacaactttttaaaaaaattaatcgaa
gttgctgcaggagttcaaggctccggttgggcctggctaggattttgtcccgcaaaacaa
gaacttgtcttacaagcaacagcaaatcaggatcctctagagcctctcacagggaaactc
cctctgcttggcgtggatgtttgggagcacgcctattacctgcaatataaaaatgttcgt
atggattatttaaaagcctttcctcaaataattaattggggatatatagaaaatagattt
tctgaaataatatcatctaaataa

DBGET integrated database retrieval system