KEGG   Campylobacter lari CCUG 22395: UPTC4110_1378Help
Entry
UPTC4110_1378     CDS       T03551                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acp] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
clq  Campylobacter lari CCUG 22395
Pathway
clq00061  Fatty acid biosynthesis
clq00780  Biotin metabolism
clq01100  Metabolic pathways
clq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:clq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    UPTC4110_1378 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    UPTC4110_1378 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:clq01004]
    UPTC4110_1378 (fabZ)
Enzymes [BR:clq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     UPTC4110_1378 (fabZ)
Lipid biosynthesis proteins [BR:clq01004]
 Fatty acid synthase
  Component type
   UPTC4110_1378 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AJD03916
LinkDB All DBs
Position
complement(1348653..1349093)
Genome map
AA seq 146 aa AA seqDB search
MIDVMQIQKILPHRYPFLLVDKIVELKNKEVVRGYKNISISDHVFMGHFPDHPIYPGVLI
LEGMAQTGGVLAFESMDDKVDPSTKVVYFTGIDNAKFRNPVRPGDRLDYEMSVVKNRGNM
WIFQGKAFVDGQLVAEAELKAMIVDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtaatgcaaattcaaaaaattttaccacataggtatccatttttacttgta
gataaaatcgtagaattaaaaaacaaagaagttgttagaggttataaaaatattagtata
agcgatcatgtttttatggggcactttccagatcatccaatttatccaggtgtgttaatt
ttagaaggtatggcacaaactggaggggttttagcatttgaaagtatggatgataaagta
gatccaagcaccaaggtggtatattttacaggcattgataatgcaaaatttagaaatcca
gtacgtcctggtgatagacttgattatgaaatgagtgtagtaaaaaatcgtggaaatatg
tggattttccaaggaaaagcttttgtagatggacaattagttgcagaagctgaacttaaa
gccatgatagtagataaatga

DBGET integrated database retrieval system