KEGG   Campylobacter lari RM16701: UPTC16701_0575Help
Entry
UPTC16701_0575    CDS       T03550                                 

Definition
(GenBank) hypothetical protein (C-terminal FliK domain)
Organism
clr  Campylobacter lari RM16701
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_hook
Motif
Other DBs
NCBI-ProteinID: AJD04620
LinkDB All DBs
Position
complement(548028..550037)
Genome map
AA seq 669 aa AA seqDB search
MITNISNNQNQFAKNETNKENKSEKSDKKTSLNNALKNPLFSKNDPEIKLPKDYVSKIDQ
KLQELLNKLLDQIKTNKDPDLAVLKNHKDLNFAPNFANEVKKLQAELSKKPEFEKLLKVL
EDLVKPAKDINNKNLSSLVKNSGVFLEAKLNHSLKEQNLPQSFFNLLNTIKGATSENLKR
DISNLDLKNLDTTSTLKELIHILQNHKKDNKISLENTNYKTLFKLFDKIENFKNYINKNP
NSISQEKLQNIANNFIKNLSKNLALINKELAKPENIKIQNTHILKELSQSIKDLITLLKD
IKNHKNKTETTQENLNKTPHTKDIKEELKEEIKTPQKNTEDKKETQQKQESIIKDKEIQN
TKEEKIPQSKDIKENPKEEPKTQQKNAEESSKNDSKSQNLQTNNTKLEDIFKSTSGKILL
EDIFKQNVSKNLNFSQNLQEELLNNLNKELGLIGRKLNEVLKALDPKNYEAKNSLDDIKN
IEKKLELSIKDLGKITPKDTTEISSELQKDIKSTLLQVSNLAKNLDNESILNQANRLIAQ
LEFNQLLSLANNSIHTFLPFFWDDLEKSNVVFKRGKKDKFYAQINLEFEKLGKINVFLSL
SNDKYIDINMMIENVNFRKKLYERAHELKKALVKVGLLSSNFFISDIVKSKFHNQEEYND
FNMGFDTRA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgataactaatatttctaacaatcaaaatcaatttgcaaaaaacgaaacaaacaaagag
aacaaaagcgagaaatcagacaaaaaaacctcacttaataatgctttaaaaaatccttta
ttttctaaaaatgatcccgaaatcaaattacctaaagattatgtaagcaaaatcgatcaa
aaattacaagaattattaaataaacttttagatcaaatcaaaaccaacaaagatcctgat
ttagcagtattaaaaaatcacaaagatttaaattttgcacctaattttgccaatgaagtt
aaaaaacttcaagcagagctttctaaaaaacctgaatttgaaaaactgcttaaagtttta
gaagatctagttaaacccgctaaagatatcaacaataaaaatctttcatctttggtaaaa
aattcaggtgtatttttagaagcaaaactcaatcattctttaaaagagcaaaatttacca
caaagcttttttaatcttttaaataccataaaaggagctactagtgaaaatctaaaacgc
gatataagtaatttagatcttaaaaatcttgacaccacaagtacactaaaagaacttatt
cacatcttacaaaatcacaaaaaagataataaaatttctttagaaaatacaaactacaag
acactttttaaactatttgataaaatagaaaattttaaaaactatatcaataaaaatcca
aattccattagccaagaaaagctacaaaatattgctaataatttcattaaaaatctcagt
aaaaatttagcacttatcaacaaagaactagccaaacctgaaaatataaaaattcaaaat
acgcatatattaaaagagcttagtcaaagcattaaagatcttataacacttttaaaagac
ataaaaaatcacaaaaacaaaactgaaacaacacaagaaaatttaaataaaactccacac
actaaagacatcaaagaagagttaaaagaggaaataaaaactccacaaaaaaacacagag
gataaaaaagaaactcaacaaaaacaagaaagcataataaaagataaagaaattcaaaac
acaaaagaagaaaaaataccacaaagtaaagatatcaaagaaaatcctaaagaagaacca
aaaacacagcaaaaaaatgctgaagaatcaagcaaaaatgatagtaaaagtcaaaattta
caaacaaataatactaaattagaagatatatttaaaagtacttcaggtaaaattttacta
gaagatatttttaaacaaaatgtaagtaaaaatcttaattttagccaaaatttacaagaa
gagcttttaaataatcttaacaaagaactaggcctaataggaagaaaactcaacgaggtt
ttaaaagctttagatcctaaaaattatgaagcaaaaaattctttagatgatataaaaaat
atagaaaaaaaattagaactttctataaaagatcttggaaaaattactccaaaagatacc
acagaaatttcttcagaattgcaaaaagacattaaatccactcttttgcaagtttctaat
ctggctaaaaatttagacaatgaaagcatactaaatcaagcaaatcgtcttatagctcag
cttgagtttaatcagcttttatctttggctaataatagcattcatacttttttacctttc
ttttgggatgatttagaaaaatctaatgtagtttttaaacgcggtaaaaaagataaattt
tatgcacaaattaatcttgaatttgaaaaattaggaaaaatcaatgtatttttatcacta
agtaatgataaatacattgatataaatatgatgatagaaaatgttaattttagaaaaaaa
ctctacgaaagagcgcatgagctaaaaaaagccttagttaaagtaggacttctaagctct
aattttttcatcagtgatatagttaaaagcaaatttcacaatcaagaagaatacaatgac
tttaatatgggttttgatacaagggcttaa

DBGET integrated database retrieval system