KEGG   Campylobacter lari RM16701: UPTC16701_0592Help
Entry
UPTC16701_0592    CDS       T03550                                 

Gene name
cjaC
Definition
(GenBank) amino acid ABC transporter, periplasmic arginine/lysine/histidine-binding lipoprotein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
clr  Campylobacter lari RM16701
Brite
KEGG Orthology (KO) [BR:clr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:clr02000]
    UPTC16701_0592 (cjaC)
Transporters [BR:clr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    UPTC16701_0592 (cjaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd DUF3834 NMT1
Motif
Other DBs
NCBI-ProteinID: AJD04636
LinkDB All DBs
Position
563517..564275
Genome map
AA seq 252 aa AA seqDB search
MKKILYVVLALFGILALGACSSDKSQASASGEKVYKVGIAANYPPFDFIKDAKITGFDVD
LLEEIAKRENLKLEWVNMSFDGLIPALKAGKIDMIASAMSSTPQRLTSMDFSDTYFNTKN
LYLKLKTDSSISDKQSLEGKKIGVQLGTIQESAAKAIPNAQVVASEEMLAAILALKAGKV
DAVLTDKDIGKGYLKTNEELEAFLEENDGSSGFCVAFDKGKQTELVQKINAGLEKVKADG
TYQKIVEKYDLQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattatatgttgttttagcgttatttggtatattagctttaggtgcttgc
tcaagtgataaaagtcaagctagtgcttctggtgaaaaggtttataaagtaggtatagct
gcaaattatcctccttttgattttattaaagatgcaaaaattaccggctttgatgttgat
ttattagaagagatagcaaaaagagaaaatttaaaacttgaatgggtaaatatgagtttt
gatggtttaatccctgctttaaaagctggaaagattgatatgatagcttctgctatgagt
tcaacaccacaaagattaacaagtatggattttagtgatacttattttaatactaaaaat
ttatatttaaaattaaaaacagattctagtattagtgataagcaaagtttagaaggtaaa
aaaataggtgttcaacttggaactattcaagaaagtgctgctaaggctattccaaatgct
caagtggtagctagcgaggaaatgttagccgcgattttagctttaaaagctggtaaagta
gatgcagttttaacagataaagatattggtaagggttatttaaaaactaatgaagaatta
gaagcatttttagaagaaaatgatggaagttcaggtttttgtgtagcttttgataaagga
aaacaaactgagcttgttcaaaaaatcaatgcaggtttagaaaaagttaaagctgatggt
acttaccaaaaaattgtagaaaaatacgatttgcaataa

DBGET integrated database retrieval system