KEGG   Clostridium sp. SY8519: CXIVA_08960Help
Entry
CXIVA_08960       CDS       T01565                                 

Gene name
DdlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00473  D-Alanine metabolism
cls00550  Peptidoglycan biosynthesis
cls01100  Metabolic pathways
cls01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CXIVA_08960 (DdlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CXIVA_08960 (DdlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CXIVA_08960 (DdlA)
Enzymes [BR:cls01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CXIVA_08960 (DdlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cls01011]
 Precursor biosynthesis
  Amino acid ligase
   CXIVA_08960 (DdlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATP-grasp RimK GARS_A ATPgrasp_Ter ATPgrasp_ST Ligase_CoA ATP-grasp_5 ATPgrasp_YheCD GSP_synth
Motif
Other DBs
NCBI-ProteinID: BAK46863
UniProt: F7V284
LinkDB All DBs
Position
complement(962396..963442)
Genome map
AA seq 348 aa AA seqDB search
MDIVVLAGGLSTERDVSFVSGGQVTRALRENGHRVIMLDVFMGYGEKEQDVMGIFDRAEQ
ISAASGAVTADAPDLAAVKAMRSDQSDAFFGPNVIAICQQADIVFLALHGENGENGKVQA
AFDLFGIRYTGSDYISSALAMNKAYTKRLFMADGIPTPNGVYLEESEAPEDIAETGLGYP
CVVKPCSGGSSIGTSIAHNPEEYRQALKDAFLYDTGVIVEEYIKGREFAVGVIADHALPV
IEIAPVAGFYDYKNKYKAGSTVETCPADLPDYVAAHMQAVAVNAAASLGLHTYSRMDFLL
DDDGRMYCLEANTLPGMTPTSLLPQEAAAEGMNFNELCEKLIEISYQR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgttgtattagcaggcggactcagcacagagcgggatgtatctttcgtatcc
ggcggtcaggtgaccagggcattgcgggaaaacggacaccgggtgatcatgctggatgtg
tttatgggatatggagagaaagaacaggacgtaatgggcatttttgaccgggcggaacag
atttccgcggcgtcaggggcggtaacagccgatgctccggacctggcagctgtcaaggcg
atgcgcagcgatcagtccgatgctttcttcggtccgaatgtaattgcgatctgccagcag
gcagatattgtattcctggcactgcatggggaaaacggggaaaacggcaaggttcaggca
gcatttgatctgtttggcatccggtataccggcagcgactatatatccagcgccctggct
atgaacaaggcgtataccaagcggctgtttatggcagacggcatacctaccccgaatggg
gtttatctggaggaatccgaggcgccggaagacattgcggaaaccggactcggctatccc
tgtgtggtaaaaccctgcagcggcggttccagcatcggcacgtccattgcccataacccg
gaggaatatcggcaggcgctgaaagacgcgtttttatatgataccggtgtgattgtggaa
gaatacatcaaaggacgggaattcgcggtaggcgtgattgcggatcatgccctgccggtg
attgagattgccccggtagccggcttctatgattataagaataagtacaaagcaggcagc
acagtggaaacctgcccggctgatctgccggattatgtggcagcgcatatgcaggcggta
gcggtgaacgcggcggcatccctgggactgcatacctattcccgaatggattttctgctg
gatgacgacgggagaatgtactgcctggaggcaaatacccttccgggaatgacgcccacc
tccctgctgccgcaggaagcagcggccgaaggcatgaatttcaatgaactgtgtgaaaaa
ctgatcgaaatctcatatcagcgctga

DBGET integrated database retrieval system