KEGG   Clostridium sp. SY8519: CXIVA_25910Help
Entry
CXIVA_25910       CDS       T01565                                 

Gene name
SPS1
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cls  Clostridium sp. SY8519
Brite
KEGG Orthology (KO) [BR:cls00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cls01001]
    CXIVA_25910 (SPS1)
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CXIVA_25910 (SPS1)
Protein kinases [BR:cls01001]
 Serine/threonine kinases: Other
  Bacterial family
   CXIVA_25910 (SPS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo ECSCR Haspin_kinase RIO1 Pkinase_fungal DUF4834 Asp4 FTA2 OAD_gamma Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: BAK48560
UniProt: F7V7D2
LinkDB All DBs
Position
complement(2807834..2809906)
Genome map
AA seq 690 aa AA seqDB search
MLESGMYIANRYEIVGKVGVGGMADVYKAKDATLDRYVAIKVLKQEFCEDMNFVTKFRTE
AQSAASLEHPNIVNIYDVGSENGIYYIVMEYVEGITLKEYIQKKGKLSYKETLSIAIQVS
RGIQAAHEKGIIHRDIKPQNIIISTDGKVKVTDFGIARAASTNTIHSDVMGSVHYASPEQ
ARNGYVSDKSDIYSLGIVMYEMVTGKVPFDGDSTVQIAIQHLQDEMVSPRAYAQNLPVSL
EKIILKCTQKNPDRRYENIEELLIDLRRSLVSPNTDFVSFAPVADGATRVISEKELKEIQ
NQTEGVSPEHAAPVETREQYSPVRNENTFDPEEDAKASRKEKLITTFGIIGVVVIVIIFL
LILGNIFGWFRFGSKNNTAATTQTSAVSEQTGESDSKKDDTVTMIDLKGMTYSQAKSQLE
SMGLKINQKSTEASEEYDKNEIISQDVSEGDSVKKGTTINVVVSTGKQEEEIDVPNVVGS
DASDAETLLENAGFVVKKKFDYSSTVDSGDVISQTPKAGKTAYKNDTVTITISQGMEKIK
VPDVIGMSQSEAQSALKAKGLKYTVVKDYSDDYDKGDVIAQSEKASTYVDSDTTIKLTVS
KGPKTVKYTYTGELNVPDLNEDQEVKYASVSLYDGNGTVVKYWSKITDFPYTLTATNIEN
SSSGVRKATFYFTDGTSHTYSSNVSFRKSS
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttagagagcggaatgtatatcgccaaccgatacgagatcgtcggaaaggttggcgtc
ggcggaatggccgatgtatataaggcgaaggacgcaacgcttgacagatatgtggcaatc
aaagttctgaagcaggaattctgcgaagacatgaattttgttacaaagtttcgtacagaa
gcgcagtctgccgccagcctggaacatcccaacattgtaaatatttatgatgtaggaagt
gaaaacggcatctattatattgtcatggagtatgtggaaggcattaccctgaaggaatac
atccagaaaaagggcaaactgagctacaaggagaccttaagcatcgcgattcaggtcagc
cgcggcatacaggcagcccatgaaaaagggattatccatcgggatatcaagccccagaat
attattatttccaccgacggcaaggtaaaggtaaccgatttcggcattgcccgtgccgct
tcgaccaataccatccattcggatgtgatgggctccgtccactacgcgtctccggagcag
gcccgcaacggatacgtcagcgacaagagcgatatctattccctgggaattgttatgtac
gaaatggtgaccggcaaagttccctttgacggtgacagtacggtacagatcgcgatccag
catctgcaggatgagatggtgtctccccgggcatatgcccagaacctgcccgtcagtctg
gaaaagattatcctgaaatgtacccagaaaaatccggaccgccggtatgagaatatcgag
gagctgctgattgatctgcgccgttccctggtatccccgaatacggattttgtatctttt
gccccggtggcagacggcgccacaagggttatcagcgaaaaagagctgaaagagatccag
aatcagacagaaggcgtgtccccggaacacgcggctccggtggagacacgggaacagtac
agcccggtgagaaatgagaacacgtttgatccggaggaagacgcgaaagccagccgaaaa
gaaaaactgattaccaccttcgggattatcggagttgttgtcattgtcattattttcctg
ctgattctcggaaatatcttcggatggttccgcttcggctcaaagaacaatacagcagcc
acaacccagacttcggcggtttcagagcagaccggcgaaagtgacagcaagaaggatgac
acagtcaccatgatcgacctgaaaggcatgacctacagccaggccaagagccagctggag
tccatgggactgaagatcaatcagaagagcacggaagcttccgaggaatatgacaaaaac
gagatcatttcacaggatgtatcagaaggcgactctgtgaaaaagggcacgaccatcaat
gtcgtagtcagcacaggcaagcaggaagaagaaatcgatgtgcccaatgtcgtgggcagt
gatgcgtctgacgcggagacactgctggagaatgcgggctttgtagtgaagaaaaagttc
gattacagcagtacggtggacagcggggatgtcatctcccagacaccgaaggcaggtaaa
acagcctataagaatgataccgtgacgattaccatcagccagggcatggaaaagatcaaa
gtgccggatgtcatcggcatgagtcagagcgaggcacagagcgcgctgaaggcaaaaggg
ctgaaatatacggttgtcaaggattacagcgacgattatgacaaaggggatgtcattgcc
cagagtgaaaaagcaagcacttatgtagacagtgacaccacgattaagcttaccgtcagc
aaaggaccgaaaacagtcaaatacacctacaccggcgaactgaatgtcccggatctgaat
gaagatcaggaggtaaaatacgcttcggtttctctgtatgacggcaacggcaccgttgtc
aagtactggtccaagatcacagactttccgtatacgctgaccgctacgaatatcgagaac
tccagttccggtgtgcggaaggccaccttctatttcacggatggaaccagccacacctac
agcagcaacgtaagcttcagaaaatcatcctga

DBGET integrated database retrieval system