KEGG   Clostridium bornimense: CM240_0990Help
Entry
CM240_0990        CDS       T03165                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clt  Clostridium bornimense
Pathway
clt00010  Glycolysis / Gluconeogenesis
clt00051  Fructose and mannose metabolism
clt00562  Inositol phosphate metabolism
clt01100  Metabolic pathways
clt01110  Biosynthesis of secondary metabolites
clt01120  Microbial metabolism in diverse environments
clt01130  Biosynthesis of antibiotics
clt01200  Carbon metabolism
clt01230  Biosynthesis of amino acids
Module
clt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:clt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM240_0990 (tpiA)
   00051 Fructose and mannose metabolism
    CM240_0990 (tpiA)
   00562 Inositol phosphate metabolism
    CM240_0990 (tpiA)
Enzymes [BR:clt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CM240_0990 (tpiA)
Exosome [BR:clt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CM240_0990 (tpiA)
  Exosomal proteins of bladder cancer cells
   CM240_0990 (tpiA)
  Exosomal proteins of melanoma cells
   CM240_0990 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DrsE
Motif
Other DBs
NCBI-ProteinID: CDM68154
UniProt: W6RWZ1
LinkDB All DBs
Position
rep1:1102413..1103165
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMHMTVDETVNYINEFKPLVEGANCDVVLCVPFTSLDAAVKAAKGSNVKI
GAENMHFEEKGAFTGEIAPTMLTALGVEYVVIGHSERRQYFNETDEACNKKVKKALEHNL
VPILCCGESLEQRESGVTDEVNSKQVKAAFEGVSAEDAVKVVVAYEPIWAIGTGKTATDD
QANETIMAIRATLADVYGKEVADKIRIQYGGSVKPATIKAQMAKSDIDGALVGGASLVPA
DFAQIVNFDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagccaataatcgctggaaactggaaaatgcacatgactgtagatgaaacagtt
aattatataaatgaatttaaaccattagtagaaggagcaaactgtgatgtagtactttgc
gtaccttttacatctttagatgctgctgttaaagctgctaaaggaagcaatgttaaaatc
ggtgctgaaaacatgcactttgaagaaaaaggtgctttcactggagaaatagctccaact
atgttaactgctcttggagtagaatatgttgttatcggacacagtgaaagaagacaatat
ttcaatgaaactgatgaagcttgcaacaagaaagttaaaaaagctttagaacataactta
gtaccaattctttgctgtggtgaatctttagaacaaagagaatcaggtgttacagatgaa
gtaaacagcaaacaagttaaagctgcttttgaaggtgtttctgctgaagatgcagttaaa
gttgttgttgcttacgaaccaatctgggctatcggaactggtaaaacagctactgatgat
caagcaaatgaaacaatcatggctataagagctactttagctgatgtatatggaaaagaa
gttgctgataagatcagaattcaatacggtggatcagttaagccagctacaattaaagct
caaatggctaagagtgacattgatggtgcattagttggaggagcttcattagttcctgct
gattttgcacaaatcgttaactttgataaatag

DBGET integrated database retrieval system