KEGG   Clostridium bornimense: CM240_1293Help
Entry
CM240_1293        CDS       T03165                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
clt  Clostridium bornimense
Pathway
clt00790  Folate biosynthesis
clt01100  Metabolic pathways
Module
clt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:clt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CM240_1293
Enzymes [BR:clt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CM240_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF561
Motif
Other DBs
NCBI-ProteinID: CDM68456
UniProt: W6RUW4
LinkDB All DBs
Position
rep1:complement(1442096..1442914)
Genome map
AA seq 272 aa AA seqDB search
MLIGNKEFDLKNNTYVMGILNVTPDSFSDGGKFNTIYSAIEAAKKMVEDGVDIIDIGGES
TRPGAEYVSVEEELNRVIPVIRALSKEIDIPISIDTYKSKVAEEAVKAGASLINDVWGFK
KDPDMAKVAAKYDVAVCLMHNRNNKEYNSLLDDMMDDLRESINIAKKAGVKDEKIILDPG
VGFAKTLEDNLDVMNNLEKFNELGYPVLLGTSRKSMIGLTLNLPVNERVEGTIATSVIGV
MKKMSIIRVHDVKENRRAIDMTKAILGRSING
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttaattggtaacaaggaatttgatctaaagaataatacatatgttatgggaatatta
aatgtaacgccagattcattttctgatggcggtaaatttaatactatatacagtgcaata
gaagcagctaaaaagatggtggaagatggagtagacataatagatattggcggagaatct
acaagaccaggtgcagagtatgtttcagtagaagaagaattaaatagagtaattccagta
atccgtgcattatctaaggaaatagatattccaatatctatcgatacatataaaagtaaa
gttgcagaagaagcagtaaaagctggagcatcattaattaatgatgtttggggatttaaa
aaagatcctgatatggcaaaagtagcagcaaagtatgatgtagcagtatgtcttatgcac
aatagaaataataaagagtataattcactactagatgatatgatggatgatttaagagaa
tctataaatatcgctaaaaaagctggtgttaaagatgaaaaaataattttagatcctggt
gtaggatttgctaagacactagaagataatttagatgttatgaataacttagagaagttt
aatgaattaggatatccagtattacttggaacctcaagaaaatctatgatagggttaaca
ttaaacttaccagttaatgagcgtgtagaaggaactatagcaactagtgttattggtgtt
atgaagaagatgtctataattagagttcatgacgtaaaggaaaatagaagagctatagat
atgactaaggcaatattagggagaagtataaatggataa

DBGET integrated database retrieval system