KEGG   Clostridium bornimense: CM240_1916Help
Entry
CM240_1916        CDS       T03165                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
clt  Clostridium bornimense
Brite
KEGG Orthology (KO) [BR:clt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clt01001]
    CM240_1916
Enzymes [BR:clt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CM240_1916
Protein kinases [BR:clt01001]
 Serine/threonine kinases: Other
  Bacterial family
   CM240_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH RIO1 Pkinase_fungal DUF4245 HlyD ETRAMP
Motif
Other DBs
NCBI-ProteinID: CDM69074
UniProt: W6RZM9
LinkDB All DBs
Position
rep1:complement(2104226..2106382)
Genome map
AA seq 718 aa AA seqDB search
MLGIVIADRYELLEKIGEGGMALVFKAKDLKLQRVVAVKVLKEEYLQDSEFVKKFKAEAV
AAGSISDGNIVNVFDVGTDGKVNYIVMEYLQGKTLKEIINEKGKIHFEDAIEISIQIAKA
LDCAHRSNIIHRDIKPHNIMITDYGIVKVMDFGIAKAVNSTTITNTNVVLGSVHYISPEQ
AKGQYVNKTCDLYSLGAVMYEMVTGVVPYDGDTPVSIAIKHIQEELIEPKTLNPNIPESL
NNVIVKLLQKNPDMRYQSAKELQVDLMKIKNGETLDNNNEDEFTKVLPRVDDINSMMKNN
NTNTGNNTNDVEDFNSDKSNIDYDDDEDEDIKKRNVDKKKAMIFAIALAAVLLLVVGFVV
MPALSSDSSSEKVSVPSILNLDKAEAKKKVEKVGLTFKIVEKKKSSQEEGKVINVSPKVG
TEVKKGSVVKVTISLGPGDVEVPDVTGKSQKDAEAELEEAGFKIGDITTEYSDDVTYGLV
MSQDPAGGDKVDEGETINLVISNGPKAREYNLVGKTVDDAKNEVGSFAKISVSNSTTATT
DESKDGLIASQDKTSVKINETITVTLYKYEKAKEMVQVPYLNGQNLKDVINSYKNKLTIV
ATDEYGQTITGNYGDYTVSKGPDNAGSSVEKGSTIYVTCSGKNNSNGNGNSGEINNPGDL
AGDNLGDVISQYGDKYDTEIRDSSWNLVTSNYKNYTVASAWWGSDPQGNKVLFIQTKE
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtatagttatagctgatagatatgagctgttagagaaaattggagaaggtgga
atggctctagttttcaaagctaaagatttgaaattacaacgtgtcgttgcagtaaaagtt
ttaaaggaagaatatttacaagacagtgaatttgtaaagaaatttaaagcagaagctgta
gcagcaggaagtatttctgatggaaatatagttaatgtttttgatgtaggtactgatggc
aaggttaactacattgtaatggaatatttgcaggggaaaaccttaaaagaaataataaat
gaaaaaggaaaaattcattttgaagatgctatagaaatttcaatacagatagcaaaagca
ttagattgtgcgcataggagtaatattatacatagagatataaagcctcataatattatg
attactgattatggtatagtgaaagtgatggattttggtatagctaaagcggtgaattct
acaactataacaaatactaatgtagtattaggatctgttcactatatatcgccagaacaa
gctaaagggcaatatgtaaataagacttgtgatttatattcattaggagcggtaatgtat
gaaatggttactggagtagttccttatgacggcgatactcctgtatctatagcaattaaa
catatacaagaagagttaatagaaccaaaaacactaaatcctaatataccagaatcatta
aataatgttatagttaagctactacaaaaaaatcctgatatgaggtatcaaagtgcaaaa
gaattacaagtagatcttatgaaaatcaaaaatggtgaaactttagataacaataatgaa
gatgagtttacaaaagttttacctagagtagatgatataaatagtatgatgaaaaataat
aatactaatacaggtaataacactaatgatgttgaagattttaacagtgataaaagtaat
attgattatgatgacgatgaggatgaggatattaaaaagagaaatgtagataagaagaaa
gctatgatttttgctatagccttagcagcagtattattacttgtcgtagggtttgtcgtt
atgccagcattatcatcagatagcagtagtgaaaaagtttctgtaccatctatattaaat
ttggataaagctgaagctaagaaaaaggttgaaaaagtaggtttaacatttaaaatagta
gaaaaaaagaagagttcacaagaagagggtaaagttattaatgtaagtccaaaagtagga
acagaagtaaaaaaaggttcagtagttaaagttacaatttccctaggacctggagatgta
gaagttccagatgtcactggaaagtctcaaaaggatgcagaagcagaactagaggaagct
gggttcaagattggtgatataacaacagaatatagtgatgatgttacttatggattagta
atgtctcaagatcctgcaggtggagataaagtagatgaaggtgaaactataaacttagtt
atatcaaatggtcctaaagcaagagaatataatcttgtaggcaaaactgtagatgatgca
aaaaatgaagtaggttcttttgctaaaataagtgtatcaaattcaactacagctacaact
gatgaaagtaaagatggacttattgcatctcaagataagacatctgttaagataaatgaa
acaattacagtaacactttataagtatgaaaaagcaaaagagatggtgcaagtgccatac
cttaatggacaaaacttaaaggatgtaataaattcatataaaaacaaacttacaatagtg
gcaactgatgagtatggtcaaactataactggaaattatggagactatactgtttcaaaa
ggtccagacaatgctggatcatcagtagaaaaaggttctactatttatgttacatgtagc
ggtaagaataatagtaatggtaatggcaatagtggtgaaataaataatccaggagattta
gcaggtgataatttaggtgatgttatatctcaatatggagataagtacgatacagaaatt
agagacagttcttggaatctagtgacttcaaattataaaaactatacagttgcatcggct
tggtggggtagtgatcctcaaggaaataaggtattatttattcaaacaaaagaataa

DBGET integrated database retrieval system