KEGG   Clavispora lusitaniae ATCC 42720: CLUG_00158Help
Entry
CLUG_00158        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
clu  Clavispora lusitaniae ATCC 42720
Brite
KEGG Orthology (KO) [BR:clu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clu01009]
    CLUG_00158
Protein phosphatases and associated proteins [BR:clu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLUG_00158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 8500128
NCBI-ProteinID: XP_002618999
UniProt: C4XW35
LinkDB All DBs
AA seq 367 aa AA seqDB search
MTKDIEDEITKTRKVLEETSISHTEDEGIDEEEEEDDGDDKDNGAVEYPGTVLPDPHPQE
IEADFDLTRDYEPDIQYLDLIHLKISSLEDLHLSRFQKLESLCLRQNLLTSISSIGDLPV
ETMEEIDLYDNRINHISSSVNKFVNLTSLDFSFNRIKNIKNIDKLVKLENLYFVQNKIKE
IKNLETLKNLKNLELGGNKIEEISETMHALPSLEQLWLGKNRISKFQNLSSLVNLRVLSI
QSNRIVKIEGLEDLVNLEELYVSHNGISKIENLDNNKKLTVLDVTSNRISKLENLSHLTK
LTDFWCSYNQVSSFEEVNEQLGKLPELDTVYFEGNPLQTSNPTAYRRKLRLNLGPSLAKI
DATYVRG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagacattgaagacgagattacaaaaacccgaaaggttttggaagaaacatct
atatcccacacggaagatgaaggcattgatgaagaagaagaggaggacgatggtgatgac
aaagataatggtgcagtggagtatcctgggacagtattgcccgaccctcatccccaggaa
attgaggctgactttgacttgaccagagactatgagccagacatccaataccttgacttg
attcacttgaaaatttcaagcttggaggaccttcacttgagtcgctttcagaaattggaa
tcgctctgtctcagacagaacttgctcacatccatctcatcgattggcgacttacctgtt
gaaacaatggaagaaattgatctctatgataacagaatcaaccatatcagcagcctggtc
aataaatttgtgaatttaaccagtttggatttttcatttaacagaatcaagaacatcaag
aacattgataaattggtgaaattggagaacttatattttgttcaaaacaaaatcaaagaa
ataaagaatctagagacgttgaagaacttgaaaaaccttgagttagggggcaataagata
gaagaaattagcgaaacgatgcacgcacttccgtcgcttgagcaattatggttgggcaag
aatcgtatatctaaattccaaaacttgtctagtttagtgaatttgagagtgctttctata
cagtcgaacagaattgttaagattgaagggttggaggatttagtgaatctcgaagagctc
tacgtgtctcacaatggtatatctaaaatcgaaaacttggacaataacaaaaagctcaca
gttcttgatgtgacatcgaacagaatatctaagctcgagaacctttcgcatctcaccaaa
cttacagacttttggtgttcgtataaccaagtttcatcatttgaggaggtaaatgagcaa
ttgggaaagttgcctgagctagatactgtctactttgaaggaaacccactccagacatct
aatcccacggcttacagacggaaacttcgcctcaacttgggtcctagtttggccaagatc
gatgccacgtacgtcagaggatag

DBGET integrated database retrieval system