KEGG   Clavispora lusitaniae ATCC 42720: CLUG_00374Help
Entry
CLUG_00374        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00500  Starch and sucrose metabolism
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLUG_00374
Enzymes [BR:clu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CLUG_00374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 8500103
NCBI-ProteinID: XP_002619215
UniProt: C4XWQ1
LinkDB All DBs
AA seq 540 aa AA seqDB search
MIFFYSYPMQLSLFLAWAVAASAFYIPFRLPQIPFLVSLDTKTQDEYMTDPQFELWVAQQ
SNYSFQYILENIGGVSSILDKSEVAPGVVIASPSKEHPNYFYNWIRDSALTLRSVIYYLD
DGAEHLRHAEELRAVVEQYMEINYELQRLSNPSGDFDDNTRSGLGEPKFMPDASVFKENW
GRPQSDGPGLRVSTISNYIAYLKKYKLDFSNNFLGNTSNVYYGIVRPDLEYIMANWKKDS
FDLWEEINSVHLFNALTQLRALKDGHKLAKHVGDSSEFLNLLETSFNELKNYILDSNTGF
TQFSLPYLVETPSLVQQRKRAGLDAATLLASLHAHNLEYGNTDVIPFDVEDGHVLSTISA
MVADMKYRYPINHDKIRLPQSIGVALGRYPEDIYDGYGTSEGNPWFISTATAAEVLYKWI
FKALKSNEDIVLTSEHEHFFAPFFPDDKFTTSKTIVYGSEEFGTLLVQMFNYSDSFLQVI
QAHVDSVSGKMSEQFNKYHGFMQGAESLTWSYSAFYNSVRWRLKTSTELDKYFEQANRTH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatattcttttattcatacccgatgcaacttctgttgtttttggcctgggcggtagcc
gccagtgccttttatattcccttccgccttccccagattccctttcttgtgtcattagat
accaagacccaagatgagtatatgactgatccgcagtttgagttatgggtggcccagcag
tcgaattactcattccagtatatattagagaacattggaggtgtcctgtctattctcgat
aagtcggaagtggctccaggtgttgtgatagcctctcctctgaaagaacatccaaattat
ttctacaattggattcgtgactcggcgttgacgctccggtcggtgatttattatttggat
gacggagctgaacatttacgtcatgctgaggagttgcgtgctgtggtggaacagtacatg
gagataaattatgagcttcaacggctctcaaatccttccggtgattttgacgacaatact
cgatctggacttggagaacctaagttcatgccggatgcgtctgtcttcaaagagaattgg
ggccgtccccagtcggatggccccggtttgcgtgttctgactatatccaattacattgcg
tacctcaaaaagtacaaattagacttttccaacaactttttgggcaacacatctaacgta
tactatgggattgttcggccggatttagaatacattatggccaactggaagaaagactct
ttcgacttgtgggaagagattaattctgtgcatcttttcaatgccttgactcaattgcgg
gcacttaaggatggtcacaagcttgccaagcatgtgggggactctctggaatttttaaat
ttattagaaacatctttcaatgagcttaagaactatattctagactcaaatacgggcttc
acgcaattttcgttgccgtatctcgtggaaacaccgtctcttgttcagcaacggaaaaga
gctgggcttgatgctgcaacattgttggcatccctccatgcacataacttagagtacggc
aacacggatgttattccgtttgacgtcgaagatggccatgtcctcagtactataagtgca
atggttgccgatatgaagtacaggtatccaatcaatcatgacaagattcggttgccacaa
agcattggcgtggcacttggaagatatcctgaggacatttatgacggctatggcacttct
gaaggaaacccttggttcatctccactgcaactgcggcggaagttttgtacaaatggatt
ttcaaggcgttgaagctgaatgaagatatcgtgttgacctctgaacatgaacattttttc
gcccccttttttccagacgataagtttaccacttcaaagaccatagtttacggcagcgag
gaatttggcactttgcttgtgcaaatgttcaactactcagactcattcttgcaagtgatc
caggctcacgtagatagcgtttcggggaaaatgctggagcagttcaacaaataccatggc
tttatgcaaggagcagagagtttgacgtggtcttactcggctttttacaattccgtcaga
tggaggctcaagacatcgacagaactcgacaaatacttcgagcaggcgaaccgtacacat
tag

DBGET integrated database retrieval system