KEGG   Clavispora lusitaniae ATCC 42720: CLUG_00494Help
Entry
CLUG_00494        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00020  Citrate cycle (TCA cycle)
clu00190  Oxidative phosphorylation
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
Module
clu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLUG_00494
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLUG_00494
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CLUG_00494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 8500270
NCBI-ProteinID: XP_002619336
UniProt: C4XX21
LinkDB All DBs
AA seq 629 aa AA seqDB search
MLRSFRAFSTSRAARQVIGAAKGETVNSTKYLGQKYHVIDHEYDCVVVGAGGAGLRAAFG
LAEAGFKTACVTKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYDTVKGSDWLGDQDAI
HYMTKEAPQSIYELENYGVPFSRNEEGRIYQRAFGGQSKEYGKGGQAYRTCAVADRTGHA
LLHSLYGQSLRHDTHFFIEFFAMDLMMQDGECVGVVAYNQEDGTLHRFRAHKTVLATGGY
GRAYFSCTSAHTCTGDGYAMASRAGLPLQDLEFVQFHPSGIYGSGCLITEGARGEGGYLI
NSEGERFMERYAPHAKDLASRDVVSRAITMEINEGRGVGPEKDHMFLQLSHIPASVLKER
LPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTRWTGEVLKKNEKGEDEVVPGLLAC
GEVACASVHGANRLGANSLLDLVVFGRAVSHTIRDSLTPGTPLKPVPKDLGLDSIANLDK
LRNANGTKSTAEIRLAMQKTMQKGCAVFRTQETLDECVKNINEVDETFKHVKTTDRSMIW
NSDLVETLELQNLLTCATQTAASAAARPESRGAHARDDYPDRNDAEWMKHTLSYQEKFGA
PVRLDYRNVISHTLDENDCKSVPPAKRVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaagcttcagagcgttttccacctccagagcggcccgccaggtcattggcgcc
gccaagggcgaaactgtcaactccaccaaatacttgggccaaaagtaccatgtcattgac
cacgagtacgactgtgtggttgtcggcgccggtggtgctggtcttagagcagcctttggc
ttggccgaggccggcttcaaaaccgcctgtgtcaccaagttgttccccaccagatcccac
accgtggccgcccagggcggaatcaatgctgctttgggaaacatgcacaaggacgactgg
cactggcacatgtacgacaccgtcaagggttcggactggttgggtgaccaggacgccatc
cactacatgaccaaggaggcgccccagtccatctacgagttggagaactacggtgtgccc
ttttccagaaacgaggaaggccgtatctaccagcgtgcgttcggtggccagtccaaggag
tacggtaagggtggccaggcctacagaacgtgtgccgtggctgacagaaccggccacgcc
ttgttgcactcgttgtacggccagtccttgagacacgacacgcactttttcattgagttc
ttcgccatggacttgatgatgcaggacggcgagtgtgtcggtgtggtggcctacaaccag
gaggacggtactttgcaccgtttccgcgcccacaagaccgtgttggccactggtggttac
ggtagagcctacttctcctgtacctccgcccacacctgtaccggtgacggttacgccatg
gcctcgagagctggcttgcctttgcaggacttggagtttgtgcagttccacccttcgggt
atctacggctcgggctgcttgatcaccgagggtgccagaggtgaaggtggttacttgatc
aactccgagggtgagcgtttcatggagcgttacgctcctcacgccaaggacttggcctcc
agagacgttgtttcccgtgccatcaccatggaaatcaacgaaggtagaggtgtcggccca
gaaaaggaccacatgttcttgcaattgtcccacatccctgcgtctgtgttgaaggaaaga
ttgcctggtatttctgagaccgcccacattttcgccggtgtcgacgtgaccaaggagcct
atccctatcttgcctaccgtccactacaacatgggtggtattccaaccagatggaccggt
gaggtgctcaagaagaacgagaagggcgaggatgaagttgttcctggcttgttggcttgt
ggtgaagttgcctgtgcctccgttcacggtgccaacagattgggtgccaactctttgttg
gacttggttgtttttggtagagctgtttcccacaccatcagagactctttgaccccaggt
actcctctcaagcctgttcctaaggaccttggtttggactccatcgccaaccttgataag
ttgagaaacgccaacggtaccaagtccactgccgagattagattggccatgcaaaagacc
atgcaaaagggatgtgctgtgttcagaacccaagaaactttggacgaatgtgtcaagaac
atcaacgaagttgatgaaaccttcaagcatgtcaagaccaccgacagatccatgatctgg
aactccgacttggtggagactttggagttgcaaaacttgttgacttgtgccactcaaact
gctgcctctgctgctgctagacctgaatctagaggtgctcatgctagagatgactaccct
gacagaaacgatgctgaatggatgaagcacaccttgtcttaccaagagaagtttggtgct
ccagtcaggttggattacagaaatgtcattagccacaccttggatgagaacgattgtaag
tctgttcctccagccaagcgtgtctactaa

DBGET integrated database retrieval system