KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01018Help
Entry
CLUG_01018        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K19720  collagen, type III, alpha
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:clu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    CLUG_01018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:clu00536]
    CLUG_01018
Glycosaminoglycan binding proteins [BR:clu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   CLUG_01018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Flo11
Motif
Other DBs
NCBI-GeneID: 8500693
NCBI-ProteinID: XP_002619859
UniProt: C4XYJ5
LinkDB All DBs
AA seq 953 aa AA seqDB search
MLYRECLLVIKVYKYVSPSLNFCFTNRQTLRNMKTPSVYAVLLAFVIGIYPAAACFGALF
SVVHGLIDVKKKLLLGGLSGGGSSGGSGSCSSGNCGSTPSCSGDDCGPAPSGAMGGSGGC
AVNTIIKCGTDIEISARDDNEKRTLGLFPKAILAISDVTKYANGFYEVMCNFQMDKYNEI
INLIPISMISSLTFTGTGTMDYPLIQGDDTNIENWAQWSTPIVVKPEIINGKCCLPRSLA
LNIDMNSDSASGWKEVFPMQFAWKNQGSTDSCKVLTSAGQLMGSSSHKREDSPEFLAKEV
LGPHQKRGFLHFKSKAKLFESMGTQKAEFNQYCWECSCSGGPPGSGSGSGNGSGNGSGNG
SGNGSGNGSGSGSPGSPGSPGASGAPGAPGAPGPAGPAGPAGPAGPAGPSGPAGSPGSPG
SPGASGSPESPGSPGSPGASGAPGSPGSPGSPSSPSGAPGSPGSPGSPGASGSPGSPGSP
GSPGSPGASGAPGSPGSPGSPGSPGASGAPGSPGSPGSPGSPGSPGSPSSPSGSPGSPGS
PGASGSPGSPGSPGSPGSPSSPGSSESGSPGSPGSPGASGSPGSPGSPGSPGSPSSPSGS
PGSPSSPGSPGASGSPGSPGSPGSPGASGAPGSPGSPGSPGSPGSPGSPGASGSPGSPGS
PGSPSSPSGSPGSPSSPSSPGASGSPGSPGSPGSPGASGSPGSPGSPGSPSSPSGSPGSP
SSPSSPGASGSPGSPGSPGSPGASGSPGSPGSPGSPSSPSGSPGSPSSPSSPGASGSPGS
PGSPGSPGASGAPGAPGSPGSPGSPGSPSSPGSSESGSPSSPSASESGSPSSPSASESGS
PGSSGSPGSPGSPGSPGSPGSSASGSGSGSGSGSGSGSANSGPGSGSSASGSGSGSGSGS
GSGSAKSGPGGSSSGSGSGSGSGSGSGSASSGGSPNESPCEVCAEMEKERERE
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgctctatcgggaatgcttgcttgtcatcaaggtgtataaatatgtctcaccaagtttg
aacttttgttttaccaatcgacagacactacggaacatgaaaactccttcagtttacgca
gtgcttcttgccttcgttatcggtatatatccggcggctgcatgcttcggggctttattc
tccgtcgtgcatggtttgattgatgttaaaaagaaattgcttttgggtggtctcctgggt
ggaggctctagtgggggctccggctcgtgctcgagcggaaactgtggttccacgccaagc
tgttcgggtgacgactgtggacctgctccaagcggtgccatgggtggcagtggaggatgt
gctgtcaacactattattaagtgtggtactgacattgaaattagtgcaagagacgacaat
gaaaagagaactttgggcttgtttcctaaagctattttggcaatttctgatgttacaaaa
tatgctaatggcttctacgaggtcatgtgtaacttccagatggacaagtacaatgaaatt
atcaatttgattcctatcagtatgatttcgtctctcaccttcacaggtaccggtacaatg
gactacccattgatccagggtgacgataccaatatcgaaaactgggcacaatggagtact
cctatagtcgttaaaccagaaatcatcaacggcaagtgctgcttgccaagatctttggca
cttaacattgatatgaacctggattccgcttctgggtggaaagaagttttccctatgcaa
tttgcttggaagaaccaaggcagcactgattcctgtaaggttcttactagtgctggacag
cttatgggttcttcttctcacaagagagaagattcaccagaattccttgcaaaggaagta
ctcggtcctcatcagaagagaggatttttgcacttcaaatccaaggccaagctttttgaa
ctgatgggaacacagaaggccgaattcaaccaatactgttgggaatgttcatgttcaggt
ggtccaccaggctcgggctctggatcaggcaatggctcaggcaatggctcgggtaacggc
tcaggcaacggctcaggtaatggctccggctctggatctccaggatcaccaggatctcca
ggtgcatcaggtgctccaggtgccccaggtgctccaggtccagcaggtccagcaggtcca
gcgggcccagcaggcccagcaggcccatcaggcccagcgggatctccaggttccccaggt
tccccaggtgcttccggttctccagaatctccaggatctccaggttccccaggtgcttcc
ggtgctccaggctctccaggatctccaggctctccaagctctccaagtggtgctccaggc
tctccaggctctccaggctccccaggtgcttccggttctccaggttctccaggttctcca
ggctctccaggttccccaggtgcttccggtgctccaggttctccaggttctccaggctct
ccaggttccccaggtgcttccggtgctccaggttctccaggttctccaggctctccaggc
tctccaggctctccaggctctccaagctctccaagtggttctccaggttctccaggttcc
ccaggtgcttccggttctccaggttccccaggctctccaggctctccaggatcaccaagc
tctccaggttcgtctgagtctggttctccaggctctccaggttccccaggtgcttccggt
tctccaggttctccaggttctccaggttctccaggctctccaagctctccaagtggttct
ccaggatctccaagctctccaggctccccaggtgcttccggttctccaggatctccagga
tctccaggttccccaggtgcttccggtgctccaggctctccaggctctccaggctctcca
ggctccccaggctctccaggctccccaggtgcttccggttctccaggttctccaggttct
ccaggttctccaagctctccaagtggatctccaggttctccaagctctccaagctctcca
ggtgcttccggatctccaggatctccaggatctccaggttcccctggtgcctccggttct
ccaggctccccaggttctccaggttctccaagctctccaagtggatctccaggttctcca
agctctccaagctctccaggtgcttccggatctccaggatctccaggatctccaggttcc
cctggtgcctccggttctccaggctccccaggttctccaggttctccaagctctccaagt
ggatctccaggttctccaagctctccaagctctccaggtgcttccggatctccaggatct
ccaggatctccaggttcccctggtgcttccggtgctccaggtgctccaggttccccaggc
tctccaggctctccagggtcaccaagctctccaggttcatctgagtctggttctccaagc
tctccaagcgcttctgagtctggttctccaagctctccaagcgcttctgagtctggttct
cctggttcttcaggttctccaggttctccaggttctccaggttctccaggttctccaggt
tcttcagcatcaggctcaggctcaggatcaggctcaggctcaggctcaggctcggcaaac
tctggtccaggctcaggatcgtctgcctccggatcaggatcaggatcaggatcaggatca
gggtcagggtcagccaaatccggccctggcggctctagctctggctcaggttcaggttcc
ggatccggttctggatcaggctctgcttcttctggaggttcccctaatgaatctccatgt
gaagtgtgcgctgaaatggaaaaggagagagagagagagtaa

DBGET integrated database retrieval system