KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01056Help
Entry
CLUG_01056        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:clu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CLUG_01056
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:clu03400]
    CLUG_01056
Enzymes [BR:clu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CLUG_01056
DNA repair and recombination proteins [BR:clu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CLUG_01056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT BRCT_2 RNA_ligase DNA_ligase_A_C mRNA_cap_enzyme Endotoxin_N
Motif
Other DBs
NCBI-GeneID: 8500657
NCBI-ProteinID: XP_002619897
UniProt: C4XYN3
LinkDB All DBs
AA seq 961 aa AA seqDB search
MSVSTSFLDNVKEPENFNPEPAPFDLIISELVLKLESTNHENMAPFGTVSAKKVNIIEEF
IKLWRTHFGVNISPALSLIFPNKDSRKYFIKDVALTRLVIKLLRLQQGSTDYSIIKNWKK
SYQQKIQLTGSNEHRSTGDLPLIIARIMSRRRDPNSVVETSVTVTEVNDVLDKLSQNTSA
SDQLEVLDPFLDRLTITEVRFFFQIILKESMLSFFERSFFIAWHPDAFNLYKVCNDIKKV
FWLLTDPEKRLTPQQLCVQPMYSFIPQSSKSLTLSYENLCKKMKSGMSLSDKDPKLVNLY
KDEGIQDHFLIEEKIDGDRMLMHMVEGNFKWHTRRRRDYTFIYGENYHLGSLTKHLTGAF
HKNVKSIVLDGEMVAWSKDRQLVLPFGTLRSAAVQEALRQFDVVDVYEGNNSWPLFIIFD
ILHLNGQDLSNLPLFYRKDLLSKVVTNVPHRFEILEWVKASTPDDIKRNMQRIVSERNEG
IMVKSFLSKYRVHSRDSTWIKVKPEYLENFGENLDLVVVGKIGRIKTSYICGLRDEEEEG
CFKSFCMVANGFSKAVYRQIESKLYNFWVNYKERKPPEDLVKFGTRKPDFWINPANSIVL
EIKARSIEVTAETPYAAGSTLHNLWCRAVREDKGYEECITLQQYQELKMRYSTDVFKQQT
VNRARKRGFENSIYDRFATKKRQRIVPKSDVFQGLHFVVATDARDLQSHELITKEEIERR
VKEYGGSILLHPKQENIQARNIIILGQYVTPRISMWVKEGFDIIRPQWVFDCIRYHTILG
IEPQHIEQSGNAKLRRSASETTDKYGDSYVISFPSSKGLFKWLKKIPMSQQLSAGCLEDC
RKDFYNAEKLSNMSLFAGSHFYVLEGGDNSTDNAIHKQAQRRILRFGGSLSLDATNCTYV
VVPDEVLTNKKLQEAVRITSRKIAEGYEEGKKIPIIVMQSFIDESIHQAEIVASEDFRVV
I
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgtcgacgtcttttctagacaatgttaaggagcctgagaactttaatcctgaa
ccggcaccatttgatcttatcatctcggagctagttttaaagttggaatctacaaaccat
gaaaatatggctccctttggcacggtgagcgctaaaaaggtgaatatcattgaagagttc
ataaaattatggagaacgcactttggtgtcaatatctctcctgcgctttccctcattttc
cccaataaagacagtaggaagtattttattaaagatgttgctctaacacggctagtgatt
aaactcttgcgactacagcaaggatcgactgactatctgataataaaaaattggaagaaa
tcttaccaacaaaagattcaattaacgggctctaatgaacatcgactgactggcgacttg
cccttgattatcgctcgaataatgctgagaagaagagatcctaattccgtggttgaaact
tctgtcactgtaactgaagtaaacgatgttcttgataaactcagccaaaataccctggca
tctgatcaattggaagtattggacccattcttggacagattaacaatcactgaagtccgt
tttttctttcaaatcatcttgaaagaatcaatgttgtccttctttgagcgcagctttttt
attgcgtggcatcctgatgcatttaatctttacaaggtttgtaatgacataaagaaggta
ttctggctcctaacagacccagagaagagattgaccccacagcaattatgtgttcaaccg
atgtattcatttattccacagtcgtcgaaatccttaacactttcttacgaaaatttgtgc
aagaaaatgaagtctgggatgtctttatcagacaaggatcctaaactcgttaacttatac
aaggatgaaggaattcaggaccattttttaattgaagaaaaaatcgatggagatagaatg
cttatgcatatggtggaaggaaacttcaagtggcacaccagaagaaggagagactatact
ttcatttatggtgagaactatcatcttggatccttgaccaaacacttaaccggcgctttt
cataagaatgtgaaaagtattgttcttgacggtgaaatggtagcatggagcaaagatcgt
caattagtacttccatttggaactctcaggtccgctgcggttcaagaagcactaagacaa
ttcgatgtggttgatgtctatgaagggaacaatagctggccattgttcatcattttcgat
attctacatctaaatggacaagacttgagcaacttgccgttattctaccgtaaggatttg
ttgagcaaagttgttaccaatgttccacataggttcgaaatccttgaatgggttaaggct
agcacacctgatgatatcaagcgaaatatgcaacgcatcgtatccgaaagaaacgaggga
attatggtgaagtcattcttgctgaagtatcgtgtccatagcagagattccacgtggata
aaagtaaaacctgagtacttggaaaacttcggcgaaaaccttgatttagtggttgtgggc
aaaattggaagaattaaaacatcgtatatttgtgggcttcgggatgaagaagaagaagga
tgcttcaagctgttttgtatggttgctaatggcttcctgaaggcagtataccgtcagatt
gaatcaaagttatataatttttgggtaaattacaaagaaagaaagccacctgaagactta
gtgaagtttgggacaaggaaaccagatttttggatcaatcctgcaaatctgattgttttg
gaaatcaaagcgaggtccattgaggttaccgctgagacaccttatgcggctggactgact
ttacataatctatggtgccgtgctgtcagagaagacaaggggtacgaggagtgtattact
ttgcagcagtaccaggaacttaaaatgagatactcgacggatgtcttcaaacaacaaaca
gtcaaccgtgcaaggaagagaggatttgaaaattccatttatgataggttcgctactaag
aagagacagcggatcgtgccaaaaagcgacgtatttcaagggctacattttgttgttgcc
acagacgcgagagatctccagagccatgagcttataacaaaagaagagatagagcgtcgt
gtgaaggaatatggtgggtcgatattgctacacccaaaacaggaaaatatccaggcacga
aacatcataattttgggtcaatacgttacccctcgaatatcaatgtgggttaaggaaggt
tttgatatcattcgaccgcaatgggtttttgactgtatacgctaccatactatactaggg
attgaaccacaacatatcgagcaatctggaaatgcaaaattaagacgctctgcttcagaa
acaacagacaagtatggggatagttatgtaataagcttccccagtagcaaaggattgttc
aagtggctcaaaaaaatacccatgtctcagcaactttcggcaggatgtctcgaagattgc
cgcaaagacttttacaatgcggagaagttgtccaacatgtcgctattcgcaggttcgcat
ttttatgtcttagaaggcggagacaatagtacagataacgcaattcataaacaagcacaa
agaagaattctccgctttggtggctccctatccttggatgccactaattgcacatacgtg
gttgtaccagatgaagttctcacgaataagaagctacaagaagcggttcgaattacaagc
cggaaaattgctgagggatacgaagagggcaaaaaaatacccataatagtaatgcagtct
tttatcgatgagagcattcaccaagccgaaattgtggctagtgaggattttagagtggtc
atatga

DBGET integrated database retrieval system