KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01484Help
Entry
CLUG_01484        CDS       T01149                                 

Definition
(RefSeq) similar to MAP kinase
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu04011  MAPK signaling pathway - yeast
clu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:clu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    CLUG_01484
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CLUG_01484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clu01001]
    CLUG_01484
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clu03036]
    CLUG_01484
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clu04147]
    CLUG_01484
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CLUG_01484
Protein kinases [BR:clu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CLUG_01484
Chromosome and associated proteins [BR:clu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CLUG_01484
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CLUG_01484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like Seadorna_VP7 FTA2 APH
Motif
Other DBs
NCBI-GeneID: 8498847
NCBI-ProteinID: XP_002618025
UniProt: C4XZV2
LinkDB All DBs
AA seq 379 aa AA seqDB search
MDKDQPDMSHVQAYPYQAQQKASPPVQPEGSKSVTFNVSDHYQILEVVGQGAYGMVCSAI
HKPTQQKVAIKKIEPFGRSMLCLRTLRELKLLKNFNHENIISILALQRPASYEDFSEIYL
IQELMETDLHKVIRTQKLSDDHIQYFIYQTLRALKALHSANVLHRDLKPSNLLLNSNCDL
KICDFGLARSVASSEDNFGFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLS
GRPLFPGRDYHNQLWLIMEVLGTPNSEDYYNIKSKRAREYIRSLPFCKKVPLSELFGSIP
NVNPLAINLLEQLLAFNPSKRITVEMALQHPYLKIYHDPNDEPVCEPIPDDFFDFDRRKD
ELSISDLKKMLYDEIMKPL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagaccaacccgacatgctgcatgtgcaagcttacccataccaggcacagcaa
aaggcttcaccgccagtacagcctgaaggttccaaatctgtcacgtttaacgtttcggat
cactaccagatactcgaagtggttggccaaggcgcgtatggaatggtgtgtctggcaata
cacaaaccaacacaacagaaggtggcgatcaagaaaatcgaaccctttggtcgtctgatg
ctttgtttgcggacgctccgagagttgaagcttttgaagaacttcaaccacgaaaatatc
attagcatcttggcgttgcagagaccagcttcatacgaagatttctccgagatctaccta
attcaggagctcatggaaactgatttgcacaaggtgatcaggactcagaaactcagcgac
gaccacattcaatatttcatttaccagacactcagagccttgaaggctctccactcggca
aatgtgctccaccgtgacttgaaaccttcaaatttacttctcaactccaactgcgactta
aagatttgcgactttggattggcccgttctgtggcgtcgtcagaagacaattttggtttc
atgactgagtacgtggccacaagatggtatcgtgcaccagaaatcatgctcaccttccag
gaatacacaacagcaattgatgtgtggagtgtgggatgcatcttagccgaaatgcttagc
ggacgcccgcttttccctggaagagactaccataatcagttgtggttgattatggaggta
ttgggtacgcccaacctggaggattactacaacataaagctgaaacgagcgcgcgagtac
attagactgcttcccttctgtaagaaagtgccattgagcgagttgtttggcctgatcccc
aatgtgaacccgttggcaattaatcttttggaacaacttcttgccttcaacccatccaag
agaatcactgttgaaatggccttacaacatccatacttgaaaatataccacgaccctaat
gacgagccagtgtgcgagcctattcccgacgatttctttgactttgatcgtcgcaaggac
gagttgtccatcagcgacttgaagaaaatgctttatgacgagatcatgaagcctctttaa

DBGET integrated database retrieval system