KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02044Help
Entry
CLUG_02044        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
Organism
clu  Clavispora lusitaniae ATCC 42720
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 8498878
NCBI-ProteinID: XP_002618585
UniProt: C4Y1G2
LinkDB All DBs
AA seq 387 aa AA seqDB search
MGLGDKIKNLQGKDVEKYDKSAGKAVGGTTASGEAEEHIRARLAQRKEAEGHGSQAGYGA
GTGTSEAGGYGHSSAQHAPSSTHGTTHGNASSGTGTTSQNHGTSNSHTYGTSGTHGGIDT
AQGGAYGSGTNTAQGGAFSTGKTTTGGTTGNTSGATSGTHGSSYTSSTSGTSGSRAPGTG
PTSHSDAGARLDPTNHGNTTSSGYGHTTSSGYGHSAPGSGYTASGPDSKTSGTHGLAQGA
PGFAAGHVSREEENYDVSGNRVPGSGHTGYTGSGSAGVAGETNQSGYAGASGHGHGHEHG
HHGTGVESGVGSGGSGHSGDSHTGHGSGYTTGSHGKLATGDVPRGFTNFTTGNDKLDMKI
SNLPAEAQEKAHQAFQKGYQDGLKSHR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggattgggcgacaaaatcaaaaacttgcagggcaaggacgtggagaagtatgacaag
agtgcaggaaaggctgtgggcggaaccacagcttctggcgaggcggaagaacacatccgg
gccagacttgcccagcgcaaagaagccgagggccatggctctcaggccggatatggtgct
ggcactggaacttcagaggctggaggatacggccactcttcggcgcagcacgcgccttct
tccacgcatggaacgacgcacggaaacgcgtcaagtggcactgggacaacctctcaaaac
catggaacatcaaattcccacacctatggaacatctggaacccatggcggcattgacacg
gcccaaggcggcgcgtacgggtcgggaacaaacaccgcccaaggcggcgccttcagcacc
ggaaaaactactactggtggaactaccggaaatacttctggtgcaacttctggcacccat
ggaagctcttacacctctagcacctctggcacctctggctcccgtgctcccggcaccggc
cccacgtcgcactcggacgccggcgcccgtctcgacccgaccaaccacggcaacaccact
ctgagtggatacggccacacaactctgagcggatacggccactcggctccaggttcgggc
tacaccgccagcggccccgactccaagacctcgggcacgcacgggctcgcgcagggcgcg
ccgggctttgcggcgggccatgttctgagagaggaggagaactacgacgtctcaggcaac
cgtgtgcccggaagcggccacacgggctatactggcagcggcctggccggagttgcgggc
gaaaccaaccagagcggatatgctggggcctcgggccatggacatggccatgaacatgga
catcatggtactggagttgaatctggcgttggatctggcggatctggccactctggagat
tctcacaccggccacggttccggctacaccactgggtcccacggcaagttggccacaggc
gacgtgccccgcggcttcaccaacttcaccaccggcaacgacaagttggacatgaaaatc
tcgaacttgcctgcggaggcacaggaaaaggcccaccaggccttccagaagggctaccag
gacggcttgaagtcgcaccggtag

DBGET integrated database retrieval system