KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02078Help
Entry
CLUG_02078        CDS       T01149                                 

Definition
(RefSeq) isocitrate dehydrogenase, mitochondrial precursor
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00020  Citrate cycle (TCA cycle)
clu00480  Glutathione metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
clu01210  2-Oxocarboxylic acid metabolism
clu01230  Biosynthesis of amino acids
clu04146  Peroxisome
Module
clu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLUG_02078
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CLUG_02078
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CLUG_02078
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CLUG_02078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8498465
NCBI-ProteinID: XP_002618618
UniProt: C4Y1J6
LinkDB All DBs
AA seq 426 aa AA seqDB search
MLRASQSIPRRFFSASAPVSKIKVANPIVELDGDEMTRIIWARIKDKLINPYLDVDLKYY
DLGIEARDKTDDQITVDAANAIKKYGVGVKCATITPDEARVAEFGLKKMWLSPNGTIRNI
LGGTVFRESIIIPRIPRLIPGWEKPIVIGRHAHGDQYKATDLVISEPGKLELVFTPKNGG
EPVSHTVYDYKSAGVGLAMYNTDESIEGFAHSSFKMALSQKLPLYLSTKNTILKKYDGRF
KDIFQAIYEQEYAQQFEQNGLWYEHRLIDDMVAQMIKSKGGFVMALKNYDGDVQSDIVAQ
GFGSLGLMTSALMTPDGKAYESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGIAQR
GRLDGTSDVVDFASTLEKATVATVQEDGIMTKDLALACGKTNREAYVTTTEFLDAVADRL
KYSVSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagccagccaaagcattccgcggcgcttcttttccgcgtccgcgcccgtgtcc
aaaatcaaagtcgccaacccaattgtcgaattggacggcgacgaaatgaccagaatcatc
tgggcccgcatcaaggacaagttgatcaacccgtacttggacgtcgacttgaagtactac
gacttgggcatcgaggcccgtgacaaaacagacgaccagatcaccgtcgacgcggccaat
gccatcaaaaagtacggtgtcggcgtgaaatgtgccaccatcacgccggacgaggctcgt
gtggccgaattcggcttgaagaagatgtggttgtcgcccaacggcaccatccgcaacatt
ttgggcggcacggtgttccgcgagtccatcatcatcccgcggatcccccgtttgatcccc
ggttgggaaaaacccattgtcattggcagacatgcgcatggcgaccagtacaaggccacg
gacttggtgatctcggagccgggcaagttggagctcgtgttcacgcccaagaacggcggc
gagcctgtttcgcacaccgtctacgactacaagtcggccggagtcgggttggccatgtac
aacacggacgagtccattgaagggtttgcccactcgtcgttcaagatggcgttgagccag
aagttgccgttgtacttgtcgaccaagaacaccattttgaagaagtacgacgggcggttc
aaggacattttccaggccatctacgagcaggagtacgcgcagcaattcgagcagaacggc
ttgtggtacgagcaccgtttgatcgacgacatggtggcgcagatgatcaagtccaagggc
ggctttgtcatggccttgaagaactacgacggcgacgtgcagtccgacattgtggcccaa
ggatttggctctttgggcctcatgacgtcggcgttgatgactccagacggcaaggcctac
gagagcgaggcggcgcacggaaccgtcacccgccacttcagacagcaccagcaaggcaag
gaaacgtcgaccaactccattgcgtcgattttcgcctggtcgcgtggtattgcgcaaaga
ggccgtcttgacggaaccagcgacgtggtggactttgccagcacgttggaaaaggccacg
gtggccactgtgcaagaagacggcatcatgaccaaggacttggcgttggcctgtggcaaa
acaaaccgcgaggcgtatgtgaccacgacggagtttttggatgctgtggccgaccgtttg
aagtacagcgtgtctgtatag

DBGET integrated database retrieval system