KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04220Help
Entry
CLUG_04220        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00020  Citrate cycle (TCA cycle)
clu00310  Lysine degradation
clu00380  Tryptophan metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
Module
clu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLUG_04220
  09105 Amino acid metabolism
   00310 Lysine degradation
    CLUG_04220
   00380 Tryptophan metabolism
    CLUG_04220
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CLUG_04220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N R2K_2
Motif
Other DBs
NCBI-GeneID: 8496345
NCBI-ProteinID: XP_002615338
UniProt: C4Y7P2
LinkDB All DBs
AA seq 999 aa AA seqDB search
MLRAFRAHVPRARAHRALARSSYMSISRAYATDSFLQTNNSNYVEEMYQAWRQDPNSVHV
SWNAYFKNLDSGAAPSAAFVAPPTLIPTPAGGAGVGFIPGSSPHSEDVVTHLKVQLLVRA
YQVRGHQKAKIDPLGISFGSHSQVPKELTLEHYGFTDADLNKQITLGPGILPRFVQKDRE
TMSLKEIIDVCESLYCSSYGIEYIHIPSKSQCDWLRERIEIPEPFKYSVDEKRQILDRLI
WACSFESFLATKFPNDKRFGLEGAEAVVPGMKALIDASVEHGIEDVVIGMPHRGRLNMLS
NVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYKRPTTSGKHVNLSLVANPSHLEAED
GVVLGKTRAIQQYKNDIGEFKKAMPILLHGDAAFSAQGVVYETMGFESLPAYSTGGTVHI
IINNQIGFTTDPRFARSTLYPSDIAKAINAPIFHVNADDIEAVTFVFNLAAEWRATFHSD
VIIDVVGYRKHGHNETDQPAFTQPVMYQKIAEKKSVLQYYADKLVQEETFTKEDIEEHKK
WVWNILEESFAKSKEYQPTSREWLTTPWEDFKSPKELATEVLPHLPTAVDADILKKIGAE
ISEAPKGFEVHRNLKRILNSRKKTVESGEGIDWATGEALAFGSLVLEGYHVRVSGQDVER
GTFSQRHAVLHDQKSEKVYTPLQHLSEDQGAFTISNSSLSEYGVMGFEYGYSLFSPDALV
QWEAQFGDFANTAQVIIDQFIAGAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQM
CNEDQRYFPSPEKLERQHQDCNMQVAYPTTPANLFHLLRRQMHRQFRKPLVLFFSKSLLR
HPLARSDLSEFTGDSHFEWIIDDKELGKTINEKAGIKRVVLCSGQVYTALHKKRAAIEDK
ETAFIKIEQMHPFPFAQLRDALNSYPAIEDLVWCQEEPLNMGSFAYVSPRIGTTLAETDN
YKDLTLRYAGRDPSASVAAGSKAMHTAEEEAFLKEVFNQ
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagctttcagagcccacgtgccccgcgcaagggcccacagagccttggccaga
agctcgtatatgagtatttcccgcgcctatgccacagactcgtttttgcaaaccaacaac
tccaactatgtcgaggaaatgtaccaggcgtggcgccaggaccccaattccgtgcacgtg
tcgtggaacgcgtacttcaagaaccttgattcgggcgccgccccctcggctgcgtttgtc
gctccgccaacgcttattccgaccccggccgggggtgctggcgttggtttcattcccggt
tcgctgccccactcggaagacgtggtgacccacttgaaagtccagcttcttgtgcgtgcc
taccaggtgcgcggccaccagaaggccaagatcgacccattgggcatcctgtttggtagc
cacagccaggtgcccaaggaattgactttggagcactatggcttcaccgacgccgacttg
aacaagcaaatcacccttggcccaggtatcttgccgcgctttgtgcaaaaggaccgcgag
accatgtcgttgaaggagattatcgacgtgtgcgagtccttgtactgcctgtcttacggt
atcgagtacatccacattccttccaagtcgcagtgtgactggttgagagagcgcatcgag
atccccgagcctttcaagtacctggtggacgaaaaacgccagatcttggaccgtttgatc
tgggcgtgtctgttcgaatccttcttggccacaaagttccctaacgacaagcgtttcggt
cttgaaggtgccgaggccgttgtccccggtatgaaggccttgatcgacgcctctgtcgag
cacggcatcgaggacgttgtcattggtatgccccacagaggccgtttgaacatgttgtcc
aacgtggtgcgtaagccgaacgagtcgattttctctgagttcaccggctccaaggagttt
gacgaaggcagtggtgatgtcaagtaccacttgggtatgaactacaagcgtccaaccacc
ctgggcaagcacgtgaacttgtctcttgtggccaacccatcgcacttggaagccgaggac
ggtgtggtgttgggtaagacccgtgccatccagcagtacaagaacgacattggcgagttc
aagaaggccatgcctattttgttgcacggtgacgctgccttttccgcccaaggtgtcgta
tacgaaaccatgggtttcgagagcttgcctgcctactccacaggaggtactgttcacatc
atcatcaacaaccagattggtttcaccacagacccacgtttcgccagatccacgttgtac
ccttcggatatcgctaaggccatcaacgctccaatcttccacgtgaacgctgacgacatc
gaggccgtcacgtttgtgttcaacttggctgccgaatggagagccaccttccactccgac
gtgatcattgacgttgtcggttacagaaagcacggtcacaacgaaactgaccagcctgca
ttcacacaaccggtcatgtaccagaagattgccgaaaagaagtcggtgctccagtactac
gccgacaagttggtgcaagaggaaactttcaccaaggaggacattgaagaacacaagaag
tgggtgtggaacattttggaagagtcctttgccaagtccaaggagtaccagcctacgtca
cgtgagtggttgaccactccatgggaagacttcaagtcgcccaaggagttggccacagaa
gttttgccacacctcccgaccgccgttgatgccgacatcttgaagaagattggtgccgag
atctccgaggcgccaaagggctttgaggtgcacagaaacttgaagcgtattttgaactcg
agaaagaagactgtcgagtctggtgagggcatcgactgggccacaggtgaggctttggcc
tttggctccttggtgttggaaggctaccacgtgagagtctctggccaggacgttgagaga
ggtactttctcgcaacgtcacgccgttttgcatgaccaaaagtccgaaaaggtctacaca
cctttgcagcacttgtctgaggaccaaggcgctttcaccatttccaactcttccttgtcg
gaatacggtgttatgggctttgagtacggttactccttgttctctcctgatgcgcttgtg
caatgggaggcccagtttggtgactttgccaacactgcgcaagtcatcattgaccagttc
attgctggtgctgagtccaagtggaagcagagatctggcctcgtcttgtctttgcctcac
ggttacgacggtcaaggtccagagcactcttctggtagaatcgagagatacttgcaaatg
tgcaacgaagaccaacgttacttcccatctccagagaagcttgagagacaacatcaagac
tgcaacatgcaagttgcctacccaaccacacccgccaacttgttccacttgttgcgtcgt
caaatgcacagacaattcagaaaacctttggttctcttcttctccaagtccttgttgaga
cacccattggccagatccgacttgtctgagttcaccggagactcgcactttgagtggatt
atcgacgacaaggaattgggcaagaccatcaacgagaaggctggcatcaagcgtgttgtt
ctttgttcgggccaggtgtacaccgctttgcacaagaagcgtgctgccatcgaagataag
gagactgccttcatcaagattgaacaaatgcatccattcccattcgcccaattgcgcgac
gccttgaacagctatcctgccatcgaagacttggtttggtgtcaagaggagcctttgaac
atgggttccttcgcatacgtttcgccacgtattggcaccaccttggccgagaccgacaac
tacaaggacttgactctccgttacgctggtagagacccatctgcgtctgtcgctgctggt
tccaaggccatgcataccgcagaggaggaggcgttcttgaaggaggtgttcaaccagtag

DBGET integrated database retrieval system