KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05140Help
Entry
CLUG_05140        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00250  Alanine, aspartate and glutamate metabolism
clu00280  Valine, leucine and isoleucine degradation
clu00410  beta-Alanine metabolism
clu00640  Propanoate metabolism
clu00650  Butanoate metabolism
clu01100  Metabolic pathways
Module
clu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLUG_05140
   00650 Butanoate metabolism
    CLUG_05140
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLUG_05140
   00280 Valine, leucine and isoleucine degradation
    CLUG_05140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLUG_05140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clu01007]
    CLUG_05140
Enzymes [BR:clu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CLUG_05140
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CLUG_05140
Amino acid related enzymes [BR:clu01007]
 Aminotransferase (transaminase)
  Class III
   CLUG_05140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 8495469
NCBI-ProteinID: XP_002615125
UniProt: C4Y9R9
LinkDB All DBs
AA seq 487 aa AA seqDB search
MLRARQAFLSARRATSSVAAAYYPAEPTQPNLVTETIPGPKSVSLNNELGRVFDNRASYF
VTDYQNSIGNYISDADGNQMLDVYCQISSIALGYNNPELLKTAASPQMASALVNRPALAC
FPQKDYAAILEEGILAAAPPGTNKVWTALSGSCANETAFKAAFMYQAAKQRGSQDFTDED
LTSVMLNKAPGAPKRSILSFEKGFHGRLFGSLSTTRSKAIHKLDIPAFDWPVAPFPQLKY
PLEEFAAENEAEEKRCLAEFENVVKSQPPHSIAAIIVEPVQSEGGDNHASALFFQGLRDL
TLKHDILMIVDEVQTGVGASGKFWAHEHWNLTTPPDMVTFSKKFQAAGFYFSNPELQPSQ
PYRQFNTWCGDPSKALIAKTIYQEITKHNLVENTAATGNYLYQNLKTLFAKYPNKVFNLR
GENFGTFIAWDCENPTQRNELLLKMRAVGVNIGGCGDRSIRLRPTLVFENKHADLLLEAL
EHSLKDL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagccaggcaagccttcctttctgctcgccgtgctacttcttctgttgcggcg
gcctactatccagccgagcctacccagcccaatttagtcactgagaccattccaggacca
aagtctgttctgctcaacaatgaacttgggcgtgttttcgacaacagggcgtcctacttc
gtcacagactaccaaaactcgattggtaactacatttctgacgccgacggcaaccagatg
ttggatgtgtattgtcaaatctcttcgattgcgcttggatacaacaatcctgagcttttg
aaaacggccgcgtctccacaaatggccagcgcattggtcaaccgtcccgccttggcatgt
ttcccacaaaaagattacgcggccattttggaggaaggtatcttggctgccgctcctcca
ggcaccaataaagtatggacggcattgtctggatcctgtgccaacgaaactgcattcaaa
gctgcgttcatgtaccaggcagccaagcaacggggatcccaggacttcactgacgaagac
ttgacttctgtcatgttgaacaaggcgcctggtgcgcctaaaagactgatcttgtcgttc
gagaaaggtttccacggccgtttgttcggctctttgtccacgactcgttcgaaagccatt
cacaagttggacattccagcctttgattggcctgtggctcccttccctcagttgaagtat
ccgttggaggaatttgctgcggagaatgaggcagaagagaagagatgtttggcagagttc
gagaatgtcgtcaagtctcagcctcctcactccattgccgcaatcattgtggagccagtt
caatccgagggtggagacaaccacgcttctgctctctttttccaaggtttgcgtgacctc
actttgaaacacgatattctcatgattgtggatgaagtgcagaccggagttggtgcctcg
ggtaagttctgggcccacgaacactggaacttgaccactcctcccgacatggtgacattt
tccaagaaattccaggctgccggattttacttctccaacccagagttgcagccttctcag
ccatacagacaattcaacacatggtgtggtgatccatccaaggcccttattgccaagaca
atttaccaggaaatcaccaagcacaacttggtggagaatactgcagcaacaggtaactac
ttataccaaaacttgaagactttgtttgccaagtacccaaacaaggttttcaacttgcgt
ggtgaaaacttcggcacgtttattgcatgggactgtgaaaatccaacacagagaaatgag
ttgttgttgaaaatgcgtgctgtgggagtgaatattggtggctgcggcgacagatccatc
agattgagacctacgttagtctttgagaacaagcacgcggacttacttttggaagcgttg
gagcattccttgaaagacttgtaa

DBGET integrated database retrieval system