KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05283Help
Entry
CLUG_05283        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00730  Thiamine metabolism
clu00790  Folate biosynthesis
clu01100  Metabolic pathways
Module
clu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CLUG_05283
   00790 Folate biosynthesis
    CLUG_05283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clu04147]
    CLUG_05283
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clu00537]
    CLUG_05283
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CLUG_05283
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLUG_05283
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clu00537]
 Enzymes
  CLUG_05283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 8495253
NCBI-ProteinID: XP_002614505
UniProt: C4YAQ5
LinkDB All DBs
AA seq 551 aa AA seqDB search
MSEKNQPFSVYNRAPSRWTSYVFNHFTLIGVLVLYILSSHLDVSFHQAPTKKQNVIFMVT
DGMGPASLSLARSFRQHRDNLPIGDILALDKFLVGSSRTRSSSSLVTDSAAGATAFSCGL
KSYNGAIGVDPNKNPCGTILEALKLQGWHTGLVVTTRITDATPAAFSSHVDYRFQEDLIA
EQQLGGYPLGRMVDLILGGGRCHFLPQSAGGCRADSRNLVEEAKEGNWSYVENRADFDAL
AGGENVSLPLLGLLAQTDIPYDIDRNASEYPSLAEQVKTALTALSKATEKSDHGFFLLIE
GSRIDHAGHHNDPAAQVREVLAYDEAFKEVLSFIDNSDVETVAISTSDHETGGLVTSRQV
SKSYPDYIWYPQVLLNSTHSGDYLASKIVSAKQSNIFKDDESFSDFIAKSIFEQDLGIYD
YTQREIYTVKKLANIQSELMYFLNNMVSIRSRTGWTTHGHSAVDVNIYAYSNSKRIDELL
YQRDPYTGLLGNHENIEIGSFMESVTHVDLKKVTELVRKTHHSPGAMAEAQVDSLHVAAL
GEQHSGCMQKS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaaaatcagcccttctctgtctacaacagagcgcccagccgctggacttcg
tacgtcttcaaccatttcaccttgattggtgtcttggtcttgtacattttgctgtcgcat
ttagacgtttcgttccaccaggctccgaccaagaaacagaatgtcattttcatggtcaca
gacggcatgggccctgcctcgttgtcgcttgcccgttccttcagacagcacagagataac
ttgcctatcggcgatattttggcgcttgacaaatttcttgtgggtctgtccagaacccgt
tccagtagcagtttggtgacagactcagctgctggcgccacggctttcagttgtggcctc
aaatcttacaatggtgccattggcgttgacccaaacaaaaacccctgcggcaccatcttg
gaagccttgaagttgcaaggttggcacactggcttagtggtgacgacacgaatcaccgac
gccactccagcagccttcagttcacacgtcgattaccgtttccaagaggaccttattgct
gaacaacagcttggcgggtaccccttgggccgcatggtggacttgattttgggtggaggc
agatgccactttttgcctcaatccgctggaggctgtcgtgcagactcaagaaacttggtg
gaagaggcaaaggagggcaactggtcgtatgttgagaacagagcagactttgacgctttg
gccggaggtgaaaacgtcagcttgcctcttttgggtcttttagcccagacagacatcccc
tacgacattgacagaaacgccagtgaatatccgtctttggccgaacaggtgaaaacagca
ttgaccgcattgagcaaggccaccgaaaaatctgaccacggtttctttttgcttattgaa
ggctccagaatcgaccacgcgggccatcacaatgacccagcggcgcaagtgagagaagtg
ttggcctatgacgaagctttcaaagaagttctttcattcatagacaactctgatgttgaa
actgttgccatctctacttctgaccacgagacgggaggattggttacctctagacaagtg
tcgaaatcgtatccggattacatttggtaccctcaagttttgttgaacagtactcactct
ggtgactatttggctagcaaaattgtatctgccaaacagtccaacatttttaaagatgat
gaaagcttttcggattttattgccaagtcgattttcgagcaagatcttggaatctacgac
tacacgcaaagagaaatttatacggttaagaaattggccaacatacaatccgagcttatg
tactttctcaacaatatggtttccatccgctccagaacgggctggactacgcacggccac
tcagcagttgatgtgaatatttacgcgtactccaattccaaaagaattgacgaactcctt
taccaaagggacccatatacgggattacttggaaatcacgagaatatagagattggctcg
ttcatggagtctgttacccatgtggatttgaagaaagttaccgaattggtacgaaaaact
caccattctcctggagcaatggccgaggctcaagtggacagcttacatgttgcagcattg
ggagaacagcactctggatgtatgcaaaagagttaa

DBGET integrated database retrieval system