KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05574Help
Entry
CLUG_05574        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00051  Fructose and mannose metabolism
clu00052  Galactose metabolism
clu00500  Starch and sucrose metabolism
clu00520  Amino sugar and nucleotide sugar metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
Module
clu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_05574
   00051 Fructose and mannose metabolism
    CLUG_05574
   00052 Galactose metabolism
    CLUG_05574
   00500 Starch and sucrose metabolism
    CLUG_05574
   00520 Amino sugar and nucleotide sugar metabolism
    CLUG_05574
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLUG_05574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clu04131]
    CLUG_05574
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CLUG_05574
Membrane trafficking [BR:clu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CLUG_05574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8495153
NCBI-ProteinID: XP_002614796
UniProt: C4YBJ6
LinkDB All DBs
AA seq 482 aa AA seqDB search
MVRLGPKPPQHRKGTFTDVPEELIEQLRHFEQILTVSPEKLRQITDHFIGELNKGLSKKG
GNIPMIPGWVLDFPTGDETGDYLAIDLGGTNLRVVLVKLMGNHKFDTTQSKFALPKHLRT
GTSEQLWSFIAECLQKFIEEFYPDGVSAPLPLGFTFSYPASQDNITEGILQRWTKGFDIE
GVEGKDVVPMLQGAIQKLNVPVKVVALINDTTGTLVASMYTDAETKMGLIFGTGVNGAYY
DVCGDIPKLEGRLCDDVTPETPMAINCEYGSFDNEHLVLPRTEYDLVIDKESPRPGQQSF
EKMISGYYLGEVLRLILLDLHKKGLVLKNQDLSKLDEAYVMDASYPSRIEQDPFENLSDV
QDLFRDNLGIETTIAERKFIRKLAELIGERSARLSVCGIAAICKKRGYKTAHCAADGSVY
QKYPGFKERAAKGLRDIFGWADNEEDPIVIVPAEDGSGVGAAVIAALTEKRLDAGKSVGV
KQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggttagattaggtccaaagccaccccagcacagaaaaggcaccttcactgatgtgcca
gaagagctcattgagcagttgcgccactttgagcagatcctcaccgtttcgccagaaaag
ttgagacaaatcaccgaccactttatcggcgagttgaacaaaggcttgtcgaagaaagga
ggtaacattcctatgattccaggttgggtgcttgacttcccaaccggagacgagaccggt
gactacttggcgatcgacttgggtggaaccaacttgagagttgttttggtcaagttgatg
ggtaaccacaagttcgacaccacccagtccaagttcgctttgcccaagcacctcagaaca
ggcacctccgaacagttgtggagcttcattgccgagtgcttgcagaagttcattgaggag
ttctacccagatggtgtcagtgccccattgccattgggtttcaccttctcgtacccagcc
tcgcaagacaacatcaccgagggtattttgcaaagatggaccaagggctttgacattgag
ggagttgaaggcaaggacgttgttcctatgttgcaaggtgccatccaaaagttgaacgtg
ccagtcaaggttgtggccttgattaacgacaccaccggtactcttgttgcttccatgtac
accgatgccgagaccaagatgggtcttatctttggtaccggtgtcaacggtgcctactac
gatgtttgcggcgacattccaaagttggaaggcagattgtgcgacgacgtgaccccagaa
acgccaatggccatcaactgcgagtacggttccttcgacaacgagcacttggtgttgcca
agaaccgagtacgatcttgtcattgacaaggagtctcctagaccaggccagcagtctttc
gagaagatgatctcgggctactacttgggtgaggtgttgcgtctcattttgctcgacttg
cacaagaagggcttggttttgaagaaccaggacttgtccaagttggacgaggcttacgtc
atggacgcctcctacccatctagaatcgaacaggacccattcgagaacttgtccgacgtg
caagacttgttccgcgacaacttgggcatcgaaaccaccattgccgaaagaaaattcatc
cgtaagttggctgagttgattggtgagagatccgccagattgtctgtgtgtggtattgct
gccatctgtaaaaagagaggctacaagactgcccactgtgcagctgatggttctgtctac
cagaagtaccctggcttcaaggagagagcagccaagggtttgagagacattttcggctgg
gccgacaatgaggaagacccgatcgtgattgttcctgctgaggatggttctggtgtcggt
gctgctgtcattgctgccttgacagaaaagagattggatgctggcaagtctgtcggtgtc
aagcaataa

DBGET integrated database retrieval system