KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05816Help
Entry
CLUG_05816        CDS       T01149                                 

Definition
(RefSeq) cAMP-dependent protein kinase type 2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu04113  Meiosis - yeast
clu04138  Autophagy - yeast
clu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:clu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CLUG_05816
  09143 Cell growth and death
   04113 Meiosis - yeast
    CLUG_05816
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CLUG_05816
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clu01001]
    CLUG_05816
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:clu03019]
    CLUG_05816
   03036 Chromosome and associated proteins [BR:clu03036]
    CLUG_05816
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CLUG_05816
Protein kinases [BR:clu01001]
 Serine/threonine kinases: AGC group
  PKA family
   CLUG_05816
Messenger RNA biogenesis [BR:clu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CLUG_05816
Chromosome and associated proteins [BR:clu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CLUG_05816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 8494639
NCBI-ProteinID: XP_002614330
UniProt: C4YCH7
LinkDB All DBs
AA seq 441 aa AA seqDB search
MPTSSILRKLHLTRPNHTSEITINSLDNVHSMEYQPAVQNQGQATQLGQTGVPQAHMGQP
QVAHGQLNPGQMGQPQLSQGQSQLSSGQSQLSSGQANAGQVLQHRQQEAVQSSLLPQKST
VSKGKYSLADFTIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDER
RMLKLVEHPFLIRMWGTFQDQKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVVL
ALEYLHSHDIIYRDLKPENILLDRSGHIKITDFGFAKEVNTVTWTLCGTPDYIAPEVITS
KPYNKSVDWWSLGVLIYEMLAGYTPFYDSTPMKIYEKILSGKIHFPSLMHPDVVDLLSRL
ITADLSSRLGNLLNGPADIRNHPWFSEVVWEKLLAKDIETPYEPPIAAGVGDSSLFDHYP
EEQSDYGSVGEDPYAEYFTEF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctccagcatcctcagaaagctccaccttactagaccgaaccacacttcggaa
atcacaatcaactctttggataacgtccattcgatggagtaccagccggccgttcagaac
cagggccaagccacccaattgggccagactggcgtgccccaagcccacatgggccagcca
caggtggcgcatggccaattgaacccaggccagatgggtcagccgcaattgagccagggc
cagctgcaattgagcctgggccagctgcaattgagtctgggccaagcaaacgcaggccag
gttttgcagcaccgccaacaggaggcggtgcaatccagcctcttgccacaaaagtccacc
gtctccaaaggcaagtacctgcttgcagacttcaccatcatgcgcacgttgggcacaggg
tcgtttggccgtgtccacttggttcgctccgttcacaacggacgctactacgccattaag
gttttgaagaaacagcaggtggtgaagatgaaacaagtggaacacaccaacgacgagcgg
cgcatgttgaagttggtggagcaccccttcttgatcagaatgtggggcacgttccaggac
cagaaaaacttgtttatggtgatggactacattgaaggtggcgagttgttctcgttgttg
agaaagtcccagcgctttcccaacccagtggccaagttctacgcggctgaagtggttttg
gccttggaatacctccactcgcacgatatcatctaccgagacttgaaacccgaaaacatt
ttgttggaccgcagtggccacatcaaaatcacagattttggtttcgccaaagaagtcaac
accgtgacttggaccttgtgtggtacgccagactacattgccccagaagttatcacttcc
aagccttacaataagtctgtcgactggtggtctttgggtgttttgatttacgaaatgctt
gccggatacaccccattctacgactcgactcccatgaaaatctacgagaagatcttgtcg
ggcaaaatccacttcccgagcttgatgcaccctgacgtggtggatttattgtcgcgctta
atcactgcagacttgtcttctcgtttgggaaacttgttgaacggtccggccgatatccgt
aaccacccttggttttctgaggtggtgtgggagaaattgttggccaaggacattgaaact
ccgtacgagccaccaattgctgcaggcgtcggcgattcctctttgttcgaccattaccca
gaagagcagctggactacggctctgtgggcgaagatccttatgcggagtacttcacggag
ttctga

DBGET integrated database retrieval system