KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05892Help
Entry
CLUG_05892        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00250  Alanine, aspartate and glutamate metabolism
clu00410  beta-Alanine metabolism
clu00430  Taurine and hypotaurine metabolism
clu00650  Butanoate metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
Module
clu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLUG_05892
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLUG_05892
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLUG_05892
   00430 Taurine and hypotaurine metabolism
    CLUG_05892
Enzymes [BR:clu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CLUG_05892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Rota_NSP4
Motif
Other DBs
NCBI-GeneID: 8494767
NCBI-ProteinID: XP_002614406
UniProt: C4YC75
LinkDB All DBs
AA seq 567 aa AA seqDB search
MTLSKHVNAEKIEDSVLAKSKKIHLNNHEEYIFRFSSNQKVPKHEIPMDSSDANLVYKYI
RQGLSLDGIPSLNLASFVNTDVDEIAQKLISENLVKNLADNDEYPSLIEYQERCISILSN
MWHAPKGSDGVPKTVGTATTGSSEAIMLAGLALKKKWQEKRKAEGKSTENPNILMASVAQ
VALEKFARYFDVENRTIRVTEESDHLIDVSEIRKNVDENTIGIFVIMGSTFTGGFEPVEK
IANSLDDIEKESGLDIKIHVDGASGGFVAPFVYPHLKWDFTIPRVVSINTSGHKFGLTTA
GLGWVIWRELDRLPESLRFKLDYLGGVEETFGLNFSRPGFPVLHQYFNLLTYGVEGYAKI
YHSCLRNARVLSQVLEETKYFEVLSVIHKPIGKEEKEKTYTLKHDPRLKHRAEGTINEDF
KPGLPVVAFRFSKEFREKYPEIPQAMISLLLRNKQFIVPNYHLTPDEQDKEILRVVVRAS
LDLNLIDKLIDSIVESTELLIRAHENVISVLKHKNFASEEEKKKIIYDLLLSITSNGVTD
AKALQTARLDKPGTGHHKHKKSYRGTC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactctctccaagcacgtgaacgccgaaaaaatcgaggacagtgtccttgcaaaaagc
aaaaagatccaccttaataaccacgaggaatatatattccggttcagctcaaatcaaaag
gtgcccaagcatgaaatccccatggattccagtgatgccaatttggtgtacaagtacatc
agacagggcttgtctctcgatggaatccccagtctcaacttggcatccttcgtgaacact
gatgtggatgaaatcgcccagaaattgatctccgagaatcttgtcaagaacttggcagac
aatgatgagtacccatccttgattgagtaccaggaacgctgtattagtattttgtctaat
atgtggcatgcgccaaaaggttcagacggtgttccaaagactgtgggtacggccactacg
ggatcttcggaagcgattatgttggccggtttggcattgaagaaaaagtggcaagagaag
agaaaggccgaaggaaagtcaacggaaaaccccaatattttgatggcttctgtggcccaa
gtggctttggagaagtttgcccgttactttgacgtggaaaacagaacaattcgtgtcaca
gaggaatctgaccacttaattgacgtttctgaaatcagaaagaatgttgacgagaacacc
attggtatttttgtcattatgggctctactttcactggtggatttgagcccgtagagaag
attgccaatctgttggatgacattgagaaagaatcgggcttggatatcaagattcacgtg
gacggtgcatctggcggctttgttgcaccatttgtctatccccacttgaagtgggatttc
actatccccagagttgtgtctattaacacctcgggccacaagtttggattgaccacagct
ggtttaggatgggtcatttggcgtgagttggaccgcttgccagaatctttacgtttcaag
ttggactacttgggaggtgtcgaagagacttttgggctcaacttttctcggcccggtttt
cccgttttgcatcaatactttaacttgttgacgtatggagtggaaggttatgctaaaatc
taccacagttgtcttcggaacgcaagagtattgtcgcaagtgttggaagagacaaagtac
tttgaggttttgtctgtaattcacaagccaattggaaaggaggagaaagagaaaacgtac
acattgaaacacgaccctcggttgaagcacagagcagagggcaccattaacgaagacttc
aagccaggattgcctgttgttgcgttccggttctccaaagagtttagagaaaagtatccc
gagattccacaggcgatgatctcattgttgttgagaaacaagcagtttattgtgcccaac
taccacttgactcccgacgagcaagataaagagattttgcgtgtggttgttcgtgcttcg
ttggacttgaacttgattgacaagctcatcgattccattgtggaatcgacagaattgctt
atccgtgctcacgagaatgtgattagcgtgctcaagcacaagaactttgcctcggaagag
gaaaagaagaagattatctacgatttgctactcagcatcacatcgaatggagtcactgat
gcaaaggcattgcaaaccgctcgcttggataagccgggcacgggccaccacaagcacaag
aagtcgtaccgtggtacatgttaa

DBGET integrated database retrieval system