KEGG   Clavispora lusitaniae CBS 6936: A9F13_02g01881Help
Entry
A9F13_02g01881    CDS       T05147                                 

Definition
(GenBank) putative phosphotransferase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00010  Glycolysis / Gluconeogenesis
clus00051  Fructose and mannose metabolism
clus00052  Galactose metabolism
clus00500  Starch and sucrose metabolism
clus00520  Amino sugar and nucleotide sugar metabolism
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
clus01130  Biosynthesis of antibiotics
clus01200  Carbon metabolism
Module
clus_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clus_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9F13_02g01881
   00051 Fructose and mannose metabolism
    A9F13_02g01881
   00052 Galactose metabolism
    A9F13_02g01881
   00500 Starch and sucrose metabolism
    A9F13_02g01881
   00520 Amino sugar and nucleotide sugar metabolism
    A9F13_02g01881
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A9F13_02g01881
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clus04131]
    A9F13_02g01881
Enzymes [BR:clus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     A9F13_02g01881
Membrane trafficking [BR:clus04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    A9F13_02g01881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: OVF10382
UniProt: A0A202GCC9
LinkDB All DBs
AA seq 471 aa AA seqDB search
MNAELKSALDKITKEFEVDEAFLRKATKHFLVSMDAGLANGTPTRSFMPMIPTYVTSIPT
GKEKGLYLAADLGGTNFRVCSINLKGDHTFDLKQSKFPIPLELMQGSSSDALFSFLALKV
KNFLEEHHDDLDESTKLKLGFTFSFPVEQTALDRGSLIRWTKGFNLPDCVGRDVVEFFQK
HLDMQSVPVNIVALANDTVGTLLSRSYSNDSEKSNSHTIIGCIFGTGTNGAYFEKLSMIP
KLGGTVLPKGTQGMVINTEWGSFDNSLEVLPRTKYDDIVDRETSNVGYHLFEKRISGMFL
GELLRVTLMDLFDQGLIFTDLYKARNNTLPHRLTEPFLLSSEVLSYLQIDDSTDLKMSEL
ILENHLRLPTTKEERQIIQELTQAISNRAAYLSAIPIAAITLRVKDQYEHDDKDFEVGCD
GSIVEFYPGFRAKILEAFNLINPLKGSSKKLHLSIAKDGSGVGAALCASTT
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaattaaagtccgctttagataaaattacaaaggaattcgaggttgatgaa
gcgttcctccgcaaggccacgaaacatttcctagtttcaatggatgcggggttggctaac
ggcacaccaacaagatcgtttatgcctatgattccaacttatgtgacttcaattccaact
ggtaaagaaaaagggctttaccttgcagctgatttaggtggtacaaatttccgtgtgtgt
tcaattaatttgaagggtgatcacactttcgacttgaagcaatcgaagtttcctattcct
ttggaattgatgcaaggatcaagttcggacgccctcttctcttttttggccttgaaagtt
aaaaactttttggaagagcaccatgatgatttggacgaatcaaccaaattgaaattggga
tttacgttctcatttcctgttgagcaaactgctcttgaccgtggaagcttaattcggtgg
acaaaaggtttcaatttaccggattgtgtgggccgggatgttgtagagttcttccaaaag
catcttgatatgcaaagtgttcctgtaaacatagttgcgctagcaaatgatactgttgga
actttattgtcgagatcctactcaaatgattcagagaagagtaattcgcacacgattatt
ggctgtatctttggaaccggtacaaatggggcttactttgaaaagctttcaatgattcct
aagcttggtggcactgtcttgccaaaagggactcagggaatggtgattaatacggaatgg
ggctcattcgataactcgttggaggttttgcctcgtacaaagtatgatgatattgttgat
cgcgagacatccaatgttggctatcatctatttgaaaaacgaatcagcggaatgttctta
ggtgagttgttgagagtcacacttatggatttgtttgaccaagggctaatctttaccgac
ctatacaaggcaagaaataatactcttccacataggttaaccgaaccttttttgctttcg
tcagaggttttgtcatacttgcaaattgatgattcgactgatcttaagatgtctgaactt
attctagagaaccatttgagattacccaccactaaggaagaaaggcaaataattcaagaa
ttgactcaggctatatccaacagggctgcatatctctctgccattcctattgcagcaatc
actttgagagttaaagatcaatatgaacatgatgataaggacttcgaagttggctgcgat
ggatcaattgttgagttttatcctggtttccgtgcaaaaattttggaagccttcaatctc
atcaatcctttgaaaggactgtccaaaaagttgcatttgagtattgctaaagatggaagt
ggagtaggtgctgctctttgtgcttctacgacttga

DBGET integrated database retrieval system