KEGG   Clavispora lusitaniae CBS 6936: A9F13_02g02145Help
Entry
A9F13_02g02145    CDS       T05147                                 

Definition
(GenBank) putative isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00020  Citrate cycle (TCA cycle)
clus00480  Glutathione metabolism
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
clus01130  Biosynthesis of antibiotics
clus01200  Carbon metabolism
clus01210  2-Oxocarboxylic acid metabolism
clus01230  Biosynthesis of amino acids
clus04146  Peroxisome
Module
clus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clus_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9F13_02g02145
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A9F13_02g02145
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    A9F13_02g02145
Enzymes [BR:clus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A9F13_02g02145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: OVF10405
UniProt: A0A202GCE1
LinkDB All DBs
AA seq 426 aa AA seqDB search
MLRASQSIPRRFFSASAPVSKIKVANPIVELDGDEMTRIIWARIKDKLINPYLDVDLKYY
DLGIEARDKTDDQITVDAANAIKKYGVGVKCATITPDEARVAEFGLKKMWLSPNGTIRNI
LGGTVFRESIIIPRIPRLIPGWEKPIVIGRHAHGDQYKATDLVISEPGKLELVFTPKNGG
EPVSHTVYDYKSAGVGLAMYNTDESIEGFAHSSFKMALSQKLPLYLSTKNTILKKYDGRF
KDIFQAIYEQEYAQQFEQNGLWYEHRLIDDMVAQMIKSKGGFVMALKNYDGDVQSDIVAQ
GFGSLGLMTSALMTPDGKAYESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGIAQR
GRLDGTSDVVDFASTLEKATVATVQEDGIMTKDLALACGKTNREAYVTTTEFLDAVADRL
KNSVSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagccagccaaagcattccgcggcgcttcttttccgcgtccgcgcccgtgtcc
aaaatcaaagtcgccaaccccattgtcgaattggacggcgacgaaatgaccagaatcatc
tgggcccgcatcaaggacaagttgatcaacccgtacttggacgtcgacttgaagtactac
gacttgggcatcgaggcccgtgacaaaacagacgaccagatcactgtcgacgcggccaat
gccatcaaaaagtacggtgtcggcgtgaaatgtgccaccatcacgccggacgaggctcgt
gtggccgaattcggcttgaagaagatgtggttgtcgcccaacggcaccatccgcaacatt
ttgggcggcacggtgttccgcgagtccattatcatcccgcggatcccccgtttgatccct
ggttgggagaaacccattgtcattggcagacatgcgcatggcgaccagtacaaggccacg
gacttggtgatctcggagccgggcaagttggagcttgttttcacgcccaagaacggcggc
gagcctgtttcgcacaccgtgtacgactacaagtcggccggagtcgggttggccatgtac
aacacggacgagtccattgaagggtttgcccactcgtcgttcaagatggcgttgagccag
aagttgccgttgtacttgtcgaccaagaacaccattttgaagaagtacgacgggcggttc
aaggacattttccaggccatctacgagcaggagtacgcgcagcagttcgagcagaacggc
ttgtggtacgagcaccgtttgatcgacgacatggtggcgcagatgatcaagtccaagggc
ggctttgtcatggccttgaagaactacgacggcgacgtgcagtccgacattgtggcccag
ggctttggctctttgggcctcatgacgtcggcgttgatgactccagacggcaaggcctac
gagagcgaggcggcgcacggaaccgtcacccgccacttcaggcagcaccagcaaggcaag
gaaacgtcgaccaactccattgcgtcgattttcgcctggtcgcgtggtattgcgcaaaga
ggccgtcttgacggaaccagcgacgtggtggactttgccagcacgttggaaaaggccacg
gtggccactgtgcaagaagatggcatcatgaccaaggacttggcgttggcctgtggcaaa
acaaaccgcgaggcgtatgtgaccacgacggagtttttggatgctgtggccgaccgtttg
aagaacagcgtgtctgtatag

DBGET integrated database retrieval system