KEGG   Clavispora lusitaniae CBS 6936: A9F13_03g00924Help
Entry
A9F13_03g00924    CDS       T05147                                 

Definition
(GenBank) putative histone-lysine N-methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:clus00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    A9F13_03g00924
Enzymes [BR:clus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     A9F13_03g00924
Chromosome and associated proteins [BR:clus03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     A9F13_03g00924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26
Motif
Other DBs
NCBI-ProteinID: OVF09966
UniProt: A0A202GB61
LinkDB All DBs
AA seq 805 aa AA seqDB search
MRLVHYHPVLSHTCGIFKSFIALFLSKVSAHIQRGEKPTTSRQPGKKSLAAFISQGATPF
LDLLSAAGHFHIQFQFISAPQPSDKSDPMSREASPVLFSDAPDKTAEAVTTFVPLAECTY
LTKQLGGSGQKETMTCDCVEEWDEGKAQNLACGEDSNCINRATSVECVNGSCTCGQNCQN
QRFQKKQYSSVKVIQTEKKGYGLVAQADVPEGSFVYEYIGEVIDEKTFRARMLDYDRRNL
RHFYFMMLTKDAFIDATEKGSLARFCNHSCSPNAYVDKWVVGDKLRMGIFARRRILAGEE
ITFDYNVDRYGAQQQPCYCGSPNCMGWIGGKTQTDAALLLPDGISDALGVTRQQEKAWLK
QHKNNKSKADKEKNDKSDSGVNDEFVRSLEVEPVPLSDVNKVMGALMKVEDDSLVSKLVE
RLFLTEDAKVNTAIVRFHGYKTLSKILKQYGTDDELSLRILSILRRWPTMTRNKIESSQI
EDVVKQISSTSENQDIQNLAAGLLSDWSKLEMAYRIPKNNDASAREASTGSMSPMLGRNA
RSESPRDNDAQATGVDLDDDDDLPEGWQKAMDPNTNTVYYYHTGLGISKWERPSSAVPTG
PKAPSAPQKHKKAEKPRSKDTRPKDVRPKGPRPRNFSEDEFTRLQEEKLQKQKEEQFNGV
VEKQKLLQDLILQSQREVEEKKRLEEKLKQEKIEKYKERRRKNEAARSSSSSSSSKVSIE
TLWTKTLAKYIPNMIKKYEADIGHENIKGCARELVKILAGKETKKAPDTKPPRELDNAKL
KKLKEFSKSFMEKFLVKYRAKRAKA
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgtgcattaccatcctgtactctctcatacttgtggtatcttcaaatctttt
atcgcattgtttttatccaaagtcagcgcgcacattcagcgaggagaaaaacccaccaca
tcacgccaacctggcaaaaaatcattagctgcattcatctcgcaaggcgcaactccattc
ttggacctactatctgctgccggccatttccacatccaatttcaattcatctccgctccg
cagcctagcgacaaatccgatccaatgtctcgagaagcaagccctgtcttgttttccgat
gcgccagacaaaaccgccgaggcggtgaccacattcgtgccgcttgctgaatgtacgtat
ctcaccaagcagttgggcggctcgggccagaaagaaaccatgacctgcgactgtgtggaa
gagtgggacgaaggaaaagcccagaacttggcctgtggcgaggacagcaactgtatcaat
cgagccacgtccgttgagtgtgtgaacggtctgtgtacgtgcgggcaaaactgtcagaac
cagcgtttccagaagaaacaatacagcctggtgaaagtgatccaaacagagaaaaaaggt
tacgggcttgtggcacaggctgatgttcccgaaggtctgttcgtgtacgagtacatcggc
gaagtcattgacgagaagactttccgggccagaatgcttgactacgacagaagaaacctc
cgccacttttacttcatgatgctcaccaaagatgcgtttatcgacgccacggaaaagggc
tccttggcccgtttttgcaaccactcgtgcctgcccaacgcctatgtggacaagtgggtc
gtgggcgacaagttgcgtatgggtattttcgcccgtcggcgcattttggccggagaagaa
attactttcgactacaacgtcgaccgctatggtgcccagcagcaaccctgctattgcgga
tcgcccaattgtatgggctggatcggtggaaaaactcagaccgacgcagcgcttttgctt
cctgatggtatctctgatgctttgggtgtcactagacaacaggagaaggcatggcttaag
caacacaagaacaacaaaagcaaagctgacaaggaaaagaacgacaagagtgattctggt
gtgaatgacgagtttgttcgttctctcgaggtggaaccagtcccactctctgacgtcaat
aaagttatgggcgcattgatgaaagtcgaagatgacagtcttgtttcaaagctcgtggaa
cggttgttcttgactgaagatgctaaagttaacactgcaattgtgcgtttccacggatac
aagaccctctcgaagatcttgaaacagtatggtactgatgacgagttgagcttgcgcatt
ttgctgattttgcgccgctggccaaccatgacacgcaacaagattgaactgtcccagatc
gaagatgtggttaaacaaatcctgtccactctggagaatcaagatattcagaatttggcg
gcagggcttcttctggactggagcaaacttgaaatggcctaccgtattccaaagaacaat
gatgcttctgctcgtgaagcatctactggatcgatgtcacctatgctcggtagaaatgcg
cgtctggaactgcccagagataatgacgcccaagccactggtgtagacttggatgacgac
gatgatctccccgaaggatggcaaaaggctatggatccaaacacaaacacagtttactac
taccacactggccttggtatttccaaatgggaaagaccgtcttctgctgtacctacgggg
ccaaaggcgcctagtgcgcctcaaaaacacaaaaaggctgaaaagcccagatcaaaagat
actagaccaaaggatgttagaccgaaagggcccagaccacgcaatttctctgaggacgaa
ttcactcgtttacaggaggaaaaactccaaaaacaaaaggaggaacagttcaatggcgtg
gtggaaaaacaaaaactcttgcaagatttgattctccagtctcagagagaagtggaggaa
aagaagcgactcgaggagaaactcaaacaggaaaagatcgaaaaatataaggagagacgg
cggaagaacgaagcggcccgctcctcttcatcatcttcttcctctaaagtttccatagaa
acactttggacaaagactttagccaagtacatccctaacatgatcaaaaagtacgaggca
gatattggacacgagaatatcaaaggatgtgctcgagaattggtgaaaatcttagcaggc
aaagaaacaaaaaaggctccggacaccaagcctccacgtgaacttgacaatgctaaattg
aagaaacttaaagagtttagcaaatcgttcatggaaaagttcttggtgaaataccgtgca
aaacgggccaaggcatag

DBGET integrated database retrieval system