KEGG   Clavispora lusitaniae CBS 6936: A9F13_03g01991Help
Entry
A9F13_03g01991    CDS       T05147                                 

Definition
(GenBank) putative superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus04146  Peroxisome
clus04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:clus00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    A9F13_03g01991
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    A9F13_03g01991
Enzymes [BR:clus01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A9F13_03g01991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: OVF10061
UniProt: A0A202GBK5
LinkDB All DBs
AA seq 154 aa AA seqDB search
MVKAVAVLRGDKSVAGTVTFEQESESTPTTISWNITGNSPNALRGFHIHTFGDNTNGCTS
AGPHFNPFGKTHGAPEDDNRHVGDLGNITTDSEGVAKGTKQDILIKLLGENSIVGRSVVV
HDGTDDLGKGGHADSLKTGNAGGRPACGVIGLTE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagttgctgttcttagaggagacaagtccgttgccggtacggttactttc
gagcaagagtccgagtccactccaaccactatcagctggaacatcaccggtaactctccc
aatgccttgagaggtttccacatccacacctttggtgacaacaccaacggttgcacttcg
gctggtcctcacttcaacccatttggcaagactcacggtgccccagaagacgacaacaga
cacgttggcgacttgggtaacatcaccaccgactctgagggtgtcgccaagggcaccaag
caggacattttgatcaagttgctcggtgaaaactccattgttggcagatctgttgttgtc
catgacggcactgacgacttgggcaagggtggccacgccgactctttgaagaccggtaac
gccggtggcagacctgcttgcggtgtcattggtttgaccgagtaa

DBGET integrated database retrieval system