KEGG   Clavispora lusitaniae CBS 6936: A9F13_04g03047Help
Entry
A9F13_04g03047    CDS       T05147                                 

Definition
(GenBank) putative alpha-ketoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00020  Citrate cycle (TCA cycle)
clus00310  Lysine degradation
clus00380  Tryptophan metabolism
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
clus01130  Biosynthesis of antibiotics
clus01200  Carbon metabolism
Module
clus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9F13_04g03047
  09105 Amino acid metabolism
   00310 Lysine degradation
    A9F13_04g03047
   00380 Tryptophan metabolism
    A9F13_04g03047
Enzymes [BR:clus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A9F13_04g03047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: OVF09797
UniProt: A0A202GAR4
LinkDB All DBs
AA seq 999 aa AA seqDB search
MLRAFRAHVPRARAHRALARSSYMSISRAYATDSFLQTNNSNYVEEMYQAWRQDPNSVHV
SWNAYFKNLDSGAAPSAAFVAPPTLIPTPAGGAGVGFIPGSSPHSEDVVTHLKVQLLVRA
YQVRGHQKAKIDPLGISFGSHSQVPKELTLEHYGFTDADLNKQITLGPGILPRFVQKGRE
TMSLKEIIDVCESLYCSSYGIEYIHIPSKSQCDWLRERIEIPEPFKYSVDEKRQILDRLI
WACSFESFLATKFPNDKRFGLEGAEAVVPGMKALIDASVEHGIEDVVIGMPHRGRLNMLS
NVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYKRPTTSGKHVNLSLVANPSHLEAED
GVVLGKTRAIQQYKNDIGEFKKAMPILLHGDAAFSAQGVVYETMGFESLPAYSTGGTVHI
IINNQIGFTTDPRFARSTLYPSDIAKAINAPIFHVNADDIEAVTFVFNLAAEWRATFHSD
VIIDVVGYRKHGHNETDQPAFTQPVMYQKIAEKKSVLQYYADKLVQEETFTKEDIEEHKK
WVWNILEESFAKSKEYQPTSREWLTTPWEDFKSPKELATEVLPHLPTAVDADILKKIGAE
ISEAPKGFEVHRNLKRILNSRKKTVESGEGIDWATGEALAFGSLVLEGYHVRVSGQDVER
GTFSQRHAVLHDQKSEKVYTPLQHLSEDQGAFTISNSSLSEYGVMGFEYGYSLFSPDALV
QWEAQFGDFANTAQVIIDQFIAGAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQM
CNEDQRYFPSPEKLERQHQDCNMQVAYPTTPANLFHLLRRQMHRQFRKPLVLFFSKSLLR
HPLARSDLSEFTGDSHFEWIIDDKELGKTINEKAGIKRVVLCSGQVYTALHKKRAAIEDK
ETAFIKIEQMHPFPFAQLRDALNSYPAIEDLVWCQEEPLNMGSFAYVSPRIGTTLAETDN
YKDLTLRYAGRDPSASVAAGSKAMHTAEEEAFLKEVFNQ
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagctttcagagcccacgtgccccgcgcaagggcccacagagccttggccaga
agctcgtatatgagtatttcccgcgcctatgccacagactcgtttttgcaaaccaacaac
tccaactatgtcgaggaaatgtaccaggcgtggcgccaggaccccaattccgtgcacgtg
tcgtggaacgcgtacttcaagaaccttgattcgggcgccgccccctcggctgcgtttgtc
gctccgccaacgcttattccgaccccggccgggggcgctggcgttggtttcattcccggt
tcgctgccccactcggaagacgtggtgacccacttgaaagtccagcttcttgtgcgtgcc
taccaggtgcgcggtcaccagaaggccaagatcgacccattgggtatcctgtttggtagc
cacagccaggtccccaaggaattgactttggagcactacggtttcaccgacgccgacttg
aacaagcaaatcacccttggcccaggtatcttgccgcgctttgtgcaaaagggccgcgag
accatgtcgttgaaggagattatcgacgtgtgcgagtccttgtactgcctgtcttacggt
atcgagtacatccacattccttccaagtcgcagtgtgactggttgagagagcgcatcgag
atccccgagcctttcaagtacctggtggacgaaaaacgccagatcttggaccgtttgatc
tgggcgtgtctgttcgaatccttcttggccacaaagttccctaacgacaagcgtttcggt
cttgaaggtgccgaggccgttgtccccggtatgaaggccttgatcgacgcctctgtcgag
cacggcattgaggacgttgtcattggtatgccccacagaggccgtttgaacatgttgtcc
aacgttgtgcgtaagccgaacgagtcgattttctctgagttcaccggctccaaggaattt
gacgaaggcagtggtgatgtcaagtaccacttgggtatgaactacaagcgtccaaccacc
ctgggcaagcacgtgaacttgtctcttgtggccaacccatcgcacttggaagccgaggac
ggtgtggtgttgggtaagacccgtgccatccagcagtacaagaacgacattggcgagttc
aagaaggccatgcctattttgttgcacggtgacgctgccttttccgcccaaggtgtcgtg
tacgaaaccatgggtttcgagagcttgcctgcctactccaccggaggtactgttcacatc
atcatcaacaaccagattggtttcaccacagacccacgtttcgccagatccacgttgtac
ccttcggatattgctaaggccatcaacgctccaatcttccacgtgaacgctgacgacatc
gaggccgtcacgtttgtgttcaacttggctgccgaatggagagccaccttccactccgac
gtgatcattgacgttgtcggttacagaaagcacggtcacaacgaaactgaccagcctgca
ttcacacaaccggtcatgtaccagaagattgccgaaaagaagtcggtgctccagtactac
gccgacaagttggtgcaagaggaaactttcaccaaggaggacattgaagaacacaagaag
tgggtgtggaacattttggaagagtcctttgccaagtccaaggagtaccaacctacgtca
cgtgagtggttgaccactccatgggaagacttcaagtcgcccaaggagttggccacagaa
gttttgccacacctcccgaccgccgttgatgccgacatcttgaagaagattggtgccgag
atctccgaggcgccaaagggctttgaggtgcacagaaacttgaagcgtattttgaactcg
agaaagaagactgtcgagtctggtgagggcatcgactgggccacaggtgaggctttggcc
tttggctccttggtgttggaaggctaccacgtgagagtctctggccaggacgttgagaga
ggtactttctcgcaacgtcacgccgttttgcatgaccaaaagtccgaaaaggtctacaca
cctttgcagcacttgtctgaggaccaaggcgctttcaccatttccaactcttccttgtcg
gaatacggtgtcatgggctttgagtacggttactccttgttctctcctgatgcccttgtg
caatgggaggcccagtttggtgactttgccaacactgcgcaagtcatcattgaccagttc
attgctggtgctgagtccaagtggaagcagagatctggtctcgtcttgtctttgcctcac
ggttacgatggtcaaggtccagagcactcctctggtagaatcgagagatacttgcaaatg
tgcaacgaagaccaacgttacttcccatctccagagaagcttgagagacaacatcaagac
tgcaacatgcaagttgcctacccaaccacgcctgccaacttgttccacttgttgcgtcgt
caaatgcacagacaattcagaaaacctttggttctcttcttctccaagtccttgttgaga
cacccattggccagatctgacttgtctgagttcactggagactcgcactttgagtggatt
atcgacgacaaggaattgggcaagaccatcaacgagaaggctggcatcaagcgtgttgtt
ctttgttcgggccaggtgtacaccgctttgcacaagaagcgtgctgccatcgaagataag
gagactgccttcatcaagattgaacaaatgcatccattcccattcgcccaattgcgcgac
gccttgaacagctatcctgccatcgaagacttggtttggtgtcaagaggagcctttgaac
atgggttccttcgcatacgtttcgccacgtattggcaccaccttggccgagaccgacaac
tacaaggacttgactctccgttacgctggtagagacccatctgcgtctgtcgctgctggt
tccaaggccatgcataccgcagaggaggaggcgttcttgaaggaggtgttcaaccagtag

DBGET integrated database retrieval system