KEGG   Clavispora lusitaniae CBS 6936: A9F13_06g01397Help
Entry
A9F13_06g01397    CDS       T05147                                 

Definition
(GenBank) putative L-aspartate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00250  Alanine, aspartate and glutamate metabolism
clus00410  beta-Alanine metabolism
clus00430  Taurine and hypotaurine metabolism
clus00650  Butanoate metabolism
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
Module
clus_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9F13_06g01397
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9F13_06g01397
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9F13_06g01397
   00430 Taurine and hypotaurine metabolism
    A9F13_06g01397
Enzymes [BR:clus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A9F13_06g01397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: OVF09006
UniProt: A0A202G8F4
LinkDB All DBs
AA seq 504 aa AA seqDB search
MISSDLETDRVQELDQLLSLIHPRIVDYVASADANSEKFQANSLGSFHEPSELKKIFTSE
EGIFERGLKNDHDSLFHHIDNVLKYSVNTWNPGFLDKLYASNNPIGVISDIILSVLNTNS
HVYTVSPVLSVLENYMGRKYARLFYSNHQDTCGGLTFSGGSWSNITAMQIARSIKYPETK
LHGNGNFKFAVYASKHCHYSIEKAAILLGIGSKSVFKVDINSDGTMNTRSLEETIQKSIS
EGYTPLFINTTAGTTVFGSYDDIQAASAIAKKFNVWLHVDGSWGGNVIFSEVHKKKLKGS
EFADSITTNPHKMLGTPNTCSFLLLPDVKTFQTANSLAAPYLFHGRENDEENMDLADGTM
GCGRRADAFKFYLTWLYYGYDGLQQRVDHAFRIVEYFVQSITNLPGFTLVDEHPQCLQVC
FYYRPEGYEGDDMTNITRFISRTLHSQGRYLMDFSPNPTKDEKGEFFRVVFNSPILTDKI
IDDLVASIVSVGAAYQKKMGQSKN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatctcatctgatttagaaacggatagagtccaggaacttgaccagttgttgtcactt
atccatcctaggatagtagactatgtcgcctcggctgatgccaattccgaaaaattccaa
gctaactctttaggaagcttccacgaaccgctggaactaaagaaaatattcaccagcgag
gaagggatattcgagcggggcttgaagaacgatcacgatctgctattccaccacattgac
aacgttttgaaatactcagtaaacacatggaaccctggatttcttgacaaactttatgca
tccaataatccgattggtgtaattagcgacataattttgtcagttcttaacacgaattct
cacgtttacactgtctctccagtcctctccgtcctagaaaactatatgggcagaaagtac
gcgagactcttttatctgaatcaccaagacacatgcggcggtctcacattctctgggggc
tcatggtctaacattactgccatgcaaatcgccagatcaattaaatatcctgagacgaaa
cttcatggcaatggtaatttcaagttcgctgtttatgcttctaagcactgtcactactct
attgaaaaagctgcaattcttcttggtattggatcaaagtccgttttcaaagttgatatc
aattcggatggaacaatgaacactcgttctcttgaggaaacgattcaaaaatcaatttcg
gaaggttatacgccgcttttcatcaacacgactgcgggtacaactgttttcggactgtac
gacgatattcaagccgcttctgccattgcaaaaaaattcaatgtatggttacatgttgat
ggttcttggggtggtaatgttattttctctgaggttcacaagaaaaagctaaagggcagc
gagtttgcagactccatcactacgaacccgcacaaaatgcttggaactccaaacacatgt
tcatttcttttgcttccagatgtgaaaactttccaaacagcaaactcgcttgctgcacca
tatcttttccacggaagagagaatgacgaagaaaacatggacttggcggatggaaccatg
ggatgtggacgaagagcagatgcattcaagttctacttaacttggctctactatggttac
gatggcttgcagcagcgtgttgaccatgcttttcggattgtggagtattttgtgcaaagc
attactaatttgccagggtttactttggtagacgaacacccccagtgtcttcaggtttgc
ttctactatagaccggagggatatgaaggagatgatatgacgaatattactagattcatc
tcacgtactctccattcccaaggaagatacttgatggacttttcgccaaatccaacaaag
gatgaaaagggtgaattcttccgtgtggtgttcaactctccaattctcacagacaagatc
atagacgacttggtggcaagcattgtttccgttggagccgcataccaaaaaaaaatgggc
caactgaaaaattag

DBGET integrated database retrieval system