KEGG   Clavispora lusitaniae CBS 6936: A9F13_08g01837Help
Entry
A9F13_08g01837    CDS       T05147                                 

Definition
(GenBank) putative glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00500  Starch and sucrose metabolism
clus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9F13_08g01837
Enzymes [BR:clus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     A9F13_08g01837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: OVF08479
UniProt: A0A202G6W7
LinkDB All DBs
AA seq 532 aa AA seqDB search
MQLSLFLAWAVAASAFYIPFRLPQIPFLVSLDTKTQDEYMTDPQFELWVAQQSNYSFQYI
LENIGGVSSILDKSEVAPGVVIASPSKEHPNYFYNWIRDSALTLRSVIYYLDDGAEHLRH
SDELRAVVEQYMEINYELQRLSNPSGDFDDNTRSGLGEPKFMPDASVFKENWGRPQSDGP
GLRVSTISNYIAYLKKYKLDFSNNFLGNTSNVYYGIVRPDLEYIMANWKKDSFDLWEEIN
SVHLFNALTQLRALKDGHKLAKHVGDSSEFLNLLETSFNELKNYILDSNTGFTQFSLPYL
VETPSLVQQRKRSGLDAATLLASLHAHNLEYGNTDVIPFDVEDGHVLSTISAMVADMKYR
YPINHDKIRLPQSIGVALGRYPEDIYDGYGTSEGNPWFISTATAAEVLYKWIFKALKSNE
DIVLTSEHEHFFAPFFPDDKFTTSKTIVYGSEEFGTLLVQMFNYSDSFLQVIQAHVDSVS
GKMSEQFNKYHGFMQGAESLTWSYSAFYNSVRWRLKTSTELDKYFEQANRTH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttctgttgtttttggcctgggcggtagccgccagtgccttttatattcccttc
cgccttcctcagattccctttcttgtgtcattagataccaagacccaagatgagtatatg
actgatccgcagtttgagttatgggtggcccagcagtcgaattactcattccagtacata
ttagagaacattggaggtgttctgtctattcttgataagtcggaagtggctccaggtgtt
gtgatagcctctcctctgaaagaacatccaaattatttctacaattggattcgtgactcg
gcgttgacgctccggtcggtgatttattatttggatgacggagctgaacatttacgtcat
tctgatgagttgcgtgctgtggtggaacagtacatggagattaattatgagcttcaacgg
ctctcaaatccttccggtgattttgacgacaatactcgatctggacttggagaacctaag
ttcatgccggatgcgtctgtcttcaaagagaattggggccgtcctcagtcggatggcccc
ggtttgcgtgttctgactatatccaattacattgcgtacctcaaaaagtacaaattagac
ttttccaacaactttttgggcaacacatctaacgtatactatgggattgttcggccggat
ttagaatacattatggccaattggaagaaagactcttttgacttgtgggaagagattaac
tctgtgcatctcttcaatgccttgactcaattgcgggcacttaaggatggccacaagctt
gccaagcatgtgggggactctctggaatttttaaatttattagaaacatctttcaacgag
cttaagaactatattttagactcaaatacgggcttcacacaattttcgttgccgtatctc
gtggaaacaccgtctcttgttcagcaacgaaaaagatctgggcttgatgctgcaacattg
ttggcatccctccatgcacataacttagagtacggcaacacggatgttattccgtttgac
gtcgaagatggccatgtcctcagtactataagtgcaatggttgctgatatgaagtaccgg
tatccaatcaatcacgacaagattcggttgccacaaagcattggcgtggcacttggaaga
tatcctgaggacatttatgacgggtatggcacgtctgaaggaaacccttggttcatctcc
actgcaactgcggccgaagttttgtacaaatggattttcaaggcgttgaagctgaatgaa
gatatcgtgttgacctctgaacatgaacactttttcgcccccttttttccagacgataag
tttaccacttcaaagaccatagtttacggcagcgaggaatttggcactttgcttgtgcaa
atgttcaactactcagactcattcttgcaagtgatccaggctcacgtagatagcgtctcg
gggaaaatgctggagcagttcaacaaataccatggctttatgcaaggagcagagagtttg
acgtggtcttactcggctttttacaattccgtcagatggaggctcaagacatctacagag
ctcgacaaatacttcgagcaggcgaaccgtacacattag

DBGET integrated database retrieval system