KEGG   Clavispora lusitaniae CBS 6936: A9F13_15g01474Help
Entry
A9F13_15g01474    CDS       T05147                                 

Definition
(GenBank) putative succinate dehydrogenase [ubiquinone] flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00020  Citrate cycle (TCA cycle)
clus00190  Oxidative phosphorylation
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
clus01130  Biosynthesis of antibiotics
clus01200  Carbon metabolism
Module
clus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clus_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9F13_15g01474
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A9F13_15g01474
Enzymes [BR:clus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A9F13_15g01474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-ProteinID: OVF07164
UniProt: A0A202G359
LinkDB All DBs
AA seq 629 aa AA seqDB search
MLRSFRAFSTSRAARQVIGAAKGETVNSTKYLGQKYHVIDHEYDCVVVGAGGAGLRAAFG
LAEAGFKTACVTKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYDTVKGSDWLGDQDAI
HYMTKEAPQSIYELENYGVPFSRNEEGRIYQRAFGGQSKEYGKGGQAYRTCAVADRTGHA
LLHSLYGQSLRHDTHFFIEFFAMDLMMQDGECVGVVAYNQEDGTLHRFRAHKTVLATGGY
GRAYFSCTSAHTCTGDGYAMASRAGLPLQDLEFVQFHPSGIYGSGCLITEGARGEGGYLI
NSEGERFMERYAPHAKDLASRDVVSRAITMEINEGRGVGPEKDHMFLQLSHIPASVLKER
LPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTRWTGEVLKKNEKGEDEVVPGLLAC
GEVACASVHGANRLGANSLLDLVVFGRAVSHTIRDSLTPGTPLKPVPKDLGLDSIANLDK
LRNANGTKSTAEIRLAMQKTMQKGCAVFRTQETLDECVKNINEVDETFKHVKTTDRSMIW
NSDLVETLELQNLLTCATQTAASAAARPESRGAHARDDYPDRNDKEWMKHTLSYQEKFGA
PVRLDYRNVISHTLDENDCKSVPPAKRVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaagcttcagagcgttttccacctccagagcggcccgccaggtcattggcgcc
gccaagggcgaaactgtcaactccaccaaatacttgggccaaaagtaccatgtcattgac
cacgagtacgactgtgtggttgttggcgccggtggtgctggtcttagagcagctttcggc
ttggccgaggccggcttcaaaaccgcctgtgtcaccaagttgttccccaccagatcccac
accgtggccgcccagggcggaatcaatgctgctttgggaaacatgcacaaggacgactgg
cactggcacatgtacgacaccgtcaagggttcggactggttgggtgaccaggacgccatc
cactacatgaccaaggaggcgccccagtccatctacgagttggagaactacggtgtgccc
ttttccagaaacgaggaaggccgtatctaccagcgtgcctttggtggccagtccaaggag
tacggtaaaggtggccaggcctacagaacgtgtgccgtggctgacagaaccggccacgcc
ttgttgcactcgttgtacggccagtccttgagacacgacacgcactttttcattgagttc
ttcgccatggacttgatgatgcaggacggcgagtgtgtcggtgtggtggcctacaaccag
gaggacggtactttgcaccgtttccgcgcccacaagaccgtgttggccactggtggttac
ggtagagcctacttctcctgtacctccgcccacacctgtaccggtgacggttacgccatg
gcctcgagagctggcttgcctttgcaggacttggagtttgtgcagttccacccttcgggt
atctacggctcgggctgcttgatcaccgagggtgccagaggtgaaggtggttacttgatc
aactccgagggtgagcgtttcatggagcgttacgctcctcacgctaaggacttggcctcc
agagacgttgtttcccgtgccatcaccatggaaatcaacgaaggtagaggtgtcggccca
gaaaaggaccacatgttcttgcaattgtcgcacatccctgcgtctgtgttgaaggaaaga
ttgcctggtatttctgagaccgcccacattttcgctggtgtcgacgtgaccaaggagcct
atccctatcttgcctaccgtccactacaacatgggtggtattccaaccagatggaccggt
gaggtgctcaagaagaacgagaagggcgaggatgaagttgtccctggcttgttggcttgt
ggtgaagttgcctgtgcctccgttcacggtgccaacagattgggtgccaactctttgttg
gacttggttgttttcggtagagccgtctcccacaccattagagactccttgaccccaggt
actcctctcaagcctgttcctaaggaccttggtttggactccatcgccaaccttgataag
ttgagaaacgccaacggtaccaagtccactgccgagattagattggccatgcaaaagacc
atgcaaaagggatgtgctgtgttcagaacccaagaaactttggacgaatgtgtcaagaac
atcaacgaagttgatgaaaccttcaagcatgtcaagaccaccgacagatccatgatctgg
aactccgacttggtcgagactttggagttgcaaaacttgttgacttgtgccactcaaact
gctgcctctgctgctgctagacctgaatctagaggtgcccatgctagagatgactaccct
gacagaaacgataaagaatggatgaagcacaccttgtcttaccaagagaagtttggtgct
ccagtcaggttggattacagaaatgtcattagccacaccttggatgagaacgattgtaag
tctgttcctccagctaagcgtgtctactaa

DBGET integrated database retrieval system