KEGG   Clavispora lusitaniae CBS 6936: A9F13_17g01100Help
Entry
A9F13_17g01100    CDS       T05147                                 

Definition
(GenBank) putative alanine transaminase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00220  Arginine biosynthesis
clus00250  Alanine, aspartate and glutamate metabolism
clus01100  Metabolic pathways
clus01200  Carbon metabolism
clus01210  2-Oxocarboxylic acid metabolism
clus01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9F13_17g01100
   00220 Arginine biosynthesis
    A9F13_17g01100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clus01007]
    A9F13_17g01100
Enzymes [BR:clus01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A9F13_17g01100
Amino acid related enzymes [BR:clus01007]
 Aminotransferase (transaminase)
  Class I
   A9F13_17g01100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: OVF06889
UniProt: A0A202G2G3
LinkDB All DBs
AA seq 512 aa AA seqDB search
MSSLRLSSRSLLLKRLYASFKPAPQLTVSDLNESTLEAKYAVRGKIPIRADELRSEIDSN
PDGHGLPYDRIISANIGNPQQLDQQPLSWYRQVLSLMQYPTLINKISTLDKKTADSLYPP
DVVERARKLLKTTGSVGAYSHSQGDITVRKSVAKFISERDGYAAHPQNIFLTSGASSAVS
YLIQVLSSSPNAGFLIPIPQYPLYTASIALNNAKPIGYFLDEDNHWSTDPVQIRRLIDEN
KGNGVDLKALVVINPGNPTGAILTEKDIAEIIDIAAEHGLVLIADEVYQENVFEGKFVSM
KKVYAQLLEKDPETYKHVQLASLHSTSKGVSGECGQRGGYMELVGFSQEVRDIIFKLASI
NLCPVVSGQALVELMINPPKEGEPSYELYQKETTGIHDDLMKRASLLYKSFCAMTDVQCN
KPQGAMYLFPSLKFTKETYGKLFEASEELNLTPDEYYCTELLEKTGICCVPGNGFGQVPG
TYHLRTTFLPPGTKWIEEWTKFHEDFVSKYKN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcttcgtctcagctcgcgttctctccttttgaagcggctctatgcgagcttt
aagccagcaccccagcttactgtgtctgacttgaacgagtccactctcgaagcaaaatat
gctgtccgaggtaaaatccccattcgtgccgacgagttgaggtcggaaattgacctgaac
cctgatggtcatggcttgccatatgatcgcatcatcagtgctaacattggaaacccacaa
cagttggaccagcagccattgtcttggtacagacaagtcttgtctttgatgcaataccct
acattgattaacaaaatcagcactttggacaagaaaaccgccgactctttgtatcctccc
gatgttgtggaaagagctcgtaagttgttgaagactacaggttccgtgggtgcttactct
cactctcaaggtgatatcaccgtcagaaaatctgtcgccaagttcatttcggaaagagac
ggatacgcagcccacccacagaacattttcttgaccagtggtgcttcctctgctgtgctg
tacttgatacaagtgttatcttcaagcccaaatgctggtttcttgattcccatcccacaa
tatcctttatacactgcttcgattgcgttgaacaatgccaaacctattggctatttcttg
gacgaggacaaccactggtccacagatcccgttcagatccggcgtttgattgacgaaaac
aagggcaacggtgtggatctcaaggctttagttgtcattaatcctggtaacccaactggt
gcaatcttgaccgaaaaggacattgctgaaatcattgacattgctgcagagcacggtctt
gtgcttattgctgatgaagtctaccaggaaaatgtctttgaaggtaagttcgtgtcgatg
aagaaagtatacgcccagttgcttgagaaagatccagagacatacaaacacgtccagctt
gcatctttgcattctacatctaagggtgttagtggtgagtgtggacaaagaggcggctac
atggagttggttggcttctcccaagaagtgagagatatcatttttaagttagcttctatc
aacctttgtcctgttgtctctggccaagctttggtggagttgatgatcaacccacctaaa
gagggagagccatcttacgagttgtatcaaaaggaaactacgggaattcatgatgatttg
atgaagagagcttctcttttgtacaagtctttctgtgcaatgacagatgttcaatgtaac
aagccacaaggtgccatgtatcttttccccagcttgaagttcaccaaggagacgtacggt
aagttgtttgaagcgtctgaagagttaaacttgacaccagatgaatactactgtacagaa
ttgttggagaagacaggtatttgctgcgttccaggtaatggttttggccaggtaccggga
acataccatttaagaactacattcttgccaccaggaactaagtggatcgaggaatggact
aagtttcatgaagactttgtttctaaatacaagaattag

DBGET integrated database retrieval system