KEGG   Clavispora lusitaniae CBS 6936: A9F13_20g01034Help
Entry
A9F13_20g01034    CDS       T05147                                 

Definition
(GenBank) putative transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00030  Pentose phosphate pathway
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
clus01130  Biosynthesis of antibiotics
clus01200  Carbon metabolism
clus01230  Biosynthesis of amino acids
Module
clus_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
clus_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A9F13_20g01034
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    A9F13_20g01034
Enzymes [BR:clus01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     A9F13_20g01034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: OVF06602
UniProt: A0A202G1L0
LinkDB All DBs
AA seq 676 aa AA seqDB search
MTDIDQLAISTIRLLAVDMVGKANSGHPGAPLGLAPAAHALFKQMKFNPRNPNWINRDRF
VLSNGHACALLYSMLHLYGYGLTLDDLKEFRQLNSKTPGHPEMHDTPGVEVTSGPLGQGI
SNAVGMAIAQKQFAATYNKEDFVISDNYTYVFLGDGCLMEGVSSEASSLAGHLKLNNLIA
FWDDNKISIDGSTNVAFTEDVIKRYHAYGWNTLEISHGDTDLDGVAKAIEQAKASDKPTL
IRLTTTIGFGSLQAGTHGVHGAPLKADDIKQLKEKFGFNPEETFKVPPEVYEDYAKHVKA
NQEIEAKWYQTFNEYKAKYPTEGAELARRLDGKLPENWTEALPTYTPEDKPLATRKLSEM
LLSSVFPKVPELIGGSADLTGSNLTKAANSVDFQDPSTKLGDYSGRYIRYGVREHGMGAI
MNGIAAFGANYKNYGGTFLNFVSYAAGAVRLSALSHLPVTWVATHDSIGLGEDGPTHQPI
ETLAHLRAIPNLSVWRPADGNEVSAAYKSAIESTSTPHVIALTRQNLPQLEGSSIEAASK
GGYTLVKAENPDIIIVASGSEVSLSVNAAKVLGEQGFKVSVVSMPDFLTFDKQPQSYRLS
VLPDGVPILSVEVMSSFGWSKYSHEQFGLNRFGASGKADDLFKFFEFTPEGVSERAAKTI
QFYKGKPILSPLNRAF
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgactgacattgaccaattggctatttccaccatccgtttgttggccgttgacatggtc
ggcaaggccaactccggccacccgggcgctcctttgggcttggctcctgctgcccatgca
cttttcaagcaaatgaagttcaacccaagaaaccccaactggatcaacagagaccgtttt
gtcttgtccaatggtcacgcatgtgccttgttgtactccatgttgcacttgtacggttac
ggcttgacccttgatgacttgaaggagttcagacagttgaactcgaaaaccccaggtcac
ccagaaatgcacgacactccaggtgttgaagtgaccagtggtcctttgggtcaaggtatt
tctaacgctgttggtatggccattgctcaaaagcagtttgccgctacctacaacaaggaa
gactttgtcatctctgacaactacacttacgtctttttgggcgatggttgtttgatggag
ggtgtttcttcggaggcctcttccttggctggccacttgaagttgaacaacttgattgcc
ttctgggacgacaacaagatctccattgacggttctaccaacgttgcctttactgaagat
gtcatcaagcgttaccatgcttacggctggaacacacttgaaatttctcacggtgacacc
gacttggatggtgttgccaaggccattgaacaagccaaggccagcgacaagccaactttg
atcagattgaccaccaccattggttttggttctcttcaagctggtactcatggtgtccac
ggtgcgccattgaaggctgacgacatcaagcaattgaaggagaaatttggattcaaccca
gaagaaaccttcaaggttcctccagaagtgtacgaggactatgccaagcacgttaaggcc
aaccaggaaattgaggccaagtggtaccagacttttaatgagtacaaggccaaataccct
accgagggtgctgaattggctagaagattggatggtaagttgcctgaaaactggaccgag
gctttgccaacctacactcctgaagacaagccattggctaccagaaagttgtccgaaatg
ctcttgtctagcgtcttccctaaggttccagaactcattggtggttctgctgatttgact
ggttcgaacttgaccaaggccgccaactctgttgacttccaagacccaagcactaagttg
ggtgactactctggtcgttacatcagatacggtgtcagagagcatggtatgggtgccatc
atgaatggtatcgctgccttcggtgccaactacaagaactacggtggtaccttcttgaac
ttcgtctcttacgcagctggtgctgtgagattgtcggcattgtcccaccttccagttaca
tgggtcgctactcacgactcgattggtttgggtgaggatggtccaactcaccagcctatc
gagactttggcccacttgagagctattcctaacttgtctgtctggagaccagctgacggt
aacgaagtgtctgccgcttacaagagtgctattgagtctacctctaccccacacgttatc
gctttgaccagacaaaacttgcctcaattggagggctcttctattgaagccgcctccaag
ggtggttacaccttggttaaggctgagaacccagacatcattattgttgcttctggttct
gaagtttcgctttctgtgaatgctgccaaggtcttgggtgaacaaggtttcaaggttagc
gttgtctctatgccagacttcttgacttttgacaagcaacctcaaagctacagattgtct
gtgttgccagacggcgttccaatcttgtctgtggaggtgatgtcctcttttggttggtcc
aagtactctcatgagcaattcggtttgaacagatttggtgcttcgggtaaggctgatgat
cttttcaagttcttcgagttcactccagaaggcgtttctgagagagctgctaagaccatc
caattctacaagggtaagccaattctctcgccattgaacagagccttttaa

DBGET integrated database retrieval system