KEGG   Columba livia (rock pigeon): 102083762
Entry
102083762         CDS       T02912                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04110  Cell cycle
clv04114  Oocyte meiosis
clv04115  p53 signaling pathway
clv04218  Cellular senescence
clv04540  Gap junction
clv04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102083762 (CDK1)
   04114 Oocyte meiosis
    102083762 (CDK1)
   04115 p53 signaling pathway
    102083762 (CDK1)
   04218 Cellular senescence
    102083762 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102083762 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102083762 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102083762 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102083762 (CDK1)
   03036 Chromosome and associated proteins [BR:clv03036]
    102083762 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102083762 (CDK1)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102083762 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     102083762 (CDK1)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102083762 (CDK1)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102083762 (CDK1)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102083762 (CDK1)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102083762 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kdo Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 102083762
NCBI-ProteinID: XP_005498204
UniProt: A0A2I0MFM8
LinkDB
Position
Unknown
AA seq 302 aa
MDDYTKIEKIGEGTYGVVYKGRHKITGQVVAMKKIRLESEEEGVPSTAIREISLLKELHH
PNIVCLQDVLMQDARLYLVFEFLSMDLKKYLDTIPSGQYLDRSRVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLKTHVKNLDEDGLDLLSKMLIYDPAKRISGKMALNHPYFDDLDKSTLPANLI
KK
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatgattacacaaaaatagagaagattggggaaggtacctatggtgttgtgtataaa
ggtcggcacaaaatcacaggccaagtggttgcaatgaagaaaatacgtctagaaagtgag
gaggaaggtgttccaagtactgctatccgagaaatttctttattaaaagagctgcatcat
cccaatatagtctgtcttcaggatgttctcatgcaggacgcaagactgtacctcgtcttt
gaattcctttccatggatctcaagaaatacttggatactattccatctggccaatatttg
gatcgttcacgtgttaagagttacttgtatcaaatcttgcaaggtattgtcttctgccat
tcaagaagagttctgcacagagacttaaaacctcagaatctcttaatagatgacaaagga
gtgattaaactggcggactttggcttggctcgagcctttggaattccagtgcgggtgtac
actcatgaagtggtgacgctgtggtacaggtctccagaggtattgctaggatctgctcgt
tactctactcctgtagatatatggagcataggaaccatatttgctgagctggcaactaaa
aagccgcttttccatggggactctgagattgaccagctcttcagaatcttcagagcttta
ggaacccccaacaacgaggtgtggcctgaagtggaatccctgcaagattacaagaacaca
ttcccaaaatggaaacctggcagcctgaaaacacatgtcaaaaacttggatgaagatgga
cttgatctgctgtctaaaatgttaatttatgatcctgcaaaaagaatttctggcaaaatg
gccttgaaccatccatattttgatgacttggacaaatccactcttcctgctaacctgatt
aagaaataa

DBGET integrated database retrieval system