KEGG   Columba livia (rock pigeon): 102083945Help
Entry
102083945         CDS       T02912                                 

Gene name
SETD1B
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102083945 (SETD1B)
Enzymes [BR:clv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102083945 (SETD1B)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102083945 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     102083945 (SETD1B)
    COMPASS/SET1 complex (yeast)
     102083945 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 102083945
NCBI-ProteinID: XP_021141390
LinkDB All DBs
Position
Unknown
AA seq 1952 aa AA seqDB search
MSFREIKAGEKAKHPEDHVKKQSSSWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKK
GQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLTDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDVSPTVNETLQLTD
SLKRLKDINLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSYSQFTPQSQGTPHTPRLGT
PFSQDSTYSSRQTTPVYHFGQDSAYKARRHETKFTDAYNRRPGHHYVHNSAGVYRGPEHQ
FSTYKSHQQEPVQFSHTPPLSHSSSSSYKSAFSPYQAPAVFPQSDEQQFPQTSREPEYRR
PAPPPAEMVVESSAATNVDFVPLKEKQEEPPPLPDSNSVPEPSTASFSQTPERSETPGTP
TMESEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEIRMEGSPISSSSSQLSPIPMYGS
NSQPGYRAQTPSSRPSSTGLEDISPTPLPDSDDDEPVPGTASLSQNSRGTSEASMIPIDQ
LSRTSKIETSEAKEMVPGDQTPTSEKMDEGQHSSGEDMEISDDETNPAPITSAECAKTIV
VNSSVSNTAVMXPFPLPAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNQWGGMPMS
FQMQTQMLSRMMQAQNTYQYPPFGRMQFVNLPPYRPFSMGAALGRGQQWPPLPKFDPSVP
PPGYEPKKEDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAK
ASLTPVKSGGELEEKPKPKDRIASCLLENWNKGEGLGYEGIGLGIGLRGAIRLPSFKVKR
KEPPEAASAGDQKRIRPSTSVDDEDEESERDRDASDTTSDLSKKDADAVGLRRRPARPLE
LDSEGEEGXFKEEEQEEEGGLVKAAPGKEEEEDEEEDDDDDEDEDDDEDDDEDEDDEEEE
TGIDTSDKEEEQDSEEDVASPSSSKAEVESSDESEDSSEFESSSDSDDEDEDDDDDEDEE
EEEEEEVAEDQDREAMVAETEHEPAGHEIPDDERETILELYPVDDYMDATGLGLVEPALA
VRDEGMEEIKAGEGECGEVPEASIAAETLKQLVMERDQETKLALSPICRPEDESEATIVL
EPVVQEGPKLESQDEEATLCLSTPVGVFGEPLPSKSSFFSKSDDSSLEARVKTKLPLAAE
EDERLPRTPGREVMVHSETDTLLLPAHKVPSSMLPLPSTPGKEESLVPPEKFPEQLMVTK
TSMDEEIPRTPGRDILAKSSHPLTKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFS
YPSQSPGINSGIPRTPGRDFNFTPTFPEAGATVPCLLSGKKQSEDELDEKPFKEPLGASL
TISMNSVPSPIPFASPPQADFRTDMGLPPDEPIPVAALPCLHGDGRMPLEECKAEVKSVL
LSPEVPTGASVLPPPPPPSVLPKRRPGRPRRSPPSVLSLDMYSGKTIEPPPVPVALVESA
VGKELLSGHPDAFYGLKDPEAVTLDFRNDGFHEKIAAEAVAEKLPFKELENQWNEDFKEE
EAHAKPKRQWRRQKKTSEDLPVIPSPEYSPPQPQFKPRSEFEEMTILYDIWNGGIDEEDI
KFMCITYDRLLQQDNGMDWLNDTLWVFHPSTSFSTPKKKKRDDGMREHVTGCARSEGYYK
IDKKDKLKYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDS
DLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYE
DEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHIN
VNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5859 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgagagatcaaggcgggggaaaaagccaagcaccctgaagatcatgtcaaa
aagcagagttcaagttggatcaacggaatggagaacagcacgcaagccagcacttctgtc
gagaaaagaaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaa
ggacagcacaaactctaccgttacgatgggcaacatttcagcatgcctaactcgggaatc
gctcctgtggattgtgtcagggatcccagaatagggcgaatatggaccaaaactaaggag
ttggagctgtctgtccccaaattcaagattgatgaattttacgtggggccagtgcctccc
aagcaggtcacgtttgccaagctgaacgacaacatccgtgaaaactttttgaccgacatg
tgcaagaaatacggcgaagtggaagaggtggagattctctacaaccccaagaacaagaag
cacctgggcattgccaaagtgatctttgccacagtcaagggtgcccgggaggccgtccag
caccttcacaacacctccgtcatgggcaacatcatccacgtggagctggatacaaaaggt
gaaacccgtatgcgattctatgaactgctcgttaatggtctttacactcctcagaccctt
cccgtgggcaccgaacaggatgtgtcgccaactgtgaatgaaactctccagttgacggat
tccctgaagcgcctgaaagacattaacctttcttctgcgggatcgtctgttaccccaaac
agtagcacgccgttttcccatgacacagcctattccagctgtcggcaagatacccccaac
tcgtacagccaatttaccccacagtcccaaggaacgcctcacacgccacgcttagggacg
ccgttttcccaggattccacctattctagtcgtcagacaacacccgtgtaccattttggg
caagacagcgcgtacaaagccaggagacacgaaacaaaatttacagatgcctacaaccgc
cgcccgggacatcactatgttcataactcagcaggtgtttaccgagggccggagcatcag
tttagtacatacaaatcccatcagcaggagccagttcagttctctcacactcctcccctg
agccactctagttcttcgagctacaaatctgccttctctccctaccaagcaccagctgtg
tttccccaatctgatgagcagcagtttccccaaacttccagggaaccagagtaccgaaga
cctgcgccacctcccgctgagatggttgtggaaagcagcgctgccacgaacgtcgatttt
gtcccgttgaaggagaaacaggaggagcctccgcccttgcccgattcgaactctgttcct
gaaccgagcacagcgtccttctctcagactccagagaggagcgagacccctggcaccccc
accatggagtcagaaatgcagcataacagtttagactcaaggattgagatgctcttaaaa
gagcagagaacaaagttaccctttcttaacgagcatgactcggataacgaaatccgaatg
gaaggtagccctatttcctcttcttcttcccagctctctcccatcccaatgtacggttcg
aactctcagcctggttacagagctcagacaccttcctcgcgtccttccagtaccggcttg
gaggacattagcccgacgccgttacctgactctgacgatgacgagcccgtccctgggacg
gcttctctgagtcagaattcacgggggacgtcggaggccagcatgattcccattgatcag
ctgagcaggacctccaaaattgagacctcggaggctaaagaaatggtgcctggtgaccag
actccaacatcagaaaaaatggacgagggccagcattcttcaggggaggacatggaaatc
tccgatgatgagaccaaccccgcgcccatcaccagtgcagaatgtgccaaaaccattgtg
gtgaactcctccgtcagcaacacagccgtgatgnggccttttccgctccctgcgccaccc
ggggtccctccaccccatatcttgcctccgctccctccgttccatcctggcatgttcccc
gtcatgcaagtggatatgataagtgtcttgggcaaccagtggggtggcatgccgatgtcc
ttccaaatgcaaactcagatgctgagccgcatgatgcaggcacaaaacacgtaccagtat
ccgcctttcggacggatgcagtttgtgaatcttccgccctaccgccctttctcgatggga
gcagctctcggtcgtggacagcagtggccaccgctgcccaagtttgacccctcggttcca
ccgccgggttatgagccgaagaaggaagatccccacaaagccactgtggatggagtcctc
ctggtcatagtgaaggagctaaaggctatcatgaaaagggacctgaaccgcaagatggtt
gaagtggtggcgtttcgggcatttgacgactggtgggacaagaaggaacgtctggcaaag
gcgtctctcactccggtgaagtctggaggagaactggaggaaaaaccaaagccgaaggat
cgaatcgcatcctgtcttttggagaactggaacaaaggagaaggcctgggatatgaggga
atcggcttgggcattgggttacgaggggccatccggctgccatccttcaaggtgaaaaga
aaggagccacctgaagctgcctcagcgggggatcagaagagaatccggccttctacttct
gtcgatgatgaagatgaagagtcggagcgggacagggatgcttccgatacaacgtctgac
ctgtcgaagaaggatgcagacgccgtggggctgaggcggcgaccagcaaggccgctggag
cttgacagcgagggagaggagggtnnttttaaggaagaggagcaggaagaagagggaggc
ttggtgaaagcagcgcctggcaaggaggaagaggaggatgaggaggaggatgatgatgat
gatgaggatgaagatgatgatgaagatgatgatgaggatgaagatgatgaggaagaggag
acaggcatagacacaagtgacaaggaggaggagcaggactccgaggaggatgtagcaagt
ccgtcgtcttccaaggctgaagttgaatcatctgatgaaagtgaggactcctctgaattt
gagtcaagttcagactcggatgatgaagacgaggatgatgatgatgatgaagacgaggag
gaggaagaggaggaggaggtggctgaagatcaagacagggaagccatggttgctgagaca
gagcatgaacctgctggtcatgagattcctgatgatgagagggagactattttggagctg
taccctgtggatgactacatggatgcaacaggcctgggactcgtggagccagcgttggct
gtgagagatgaaggcatggaagaaatcaaggcaggggaaggtgaatgtggtgaagtccca
gaggcatctattgctgctgaaacactgaaacagttggttatggaaagagaccaggagaca
aaacttgcgctgtctcccatctgtaggccagaggatgagtccgaagccactatcgtgctg
gagccagtggtacaggaaggtccaaagctggaatctcaagacgaggaggcgacactctgt
ctctcgactccggtgggagtctttggagaacccctgcccagcaaaagcagcttcttcagc
aagtctgacgacagcagcttagaagctcgtgttaaaacaaaactgcccttggcagcggag
gaggacgagcgactgcctcgcacgcctgggcgggaggtgatggtccattcagagactgat
actcttctgcttccagcccacaaggtgccgtcctccatgcttcccttaccatcgactcct
ggtaaagaagaatctttagtccctccagaaaagttccctgaacaattaatggtgaccaaa
acgtccatggatgaggagattcctaggactcctgggcgggacattttggccaagtcctcg
caccccctcacgaagtcgcagagcacagacactgttccagccacgccgggaagcgatgct
ccccttacgggaagcagcttgaccctcagttctcctcaagtccctgggagccccttttcc
tacccgtcccaatctcctggcattaacagtggcattcctcggactcctgggagagatttc
aatttcacgcctactttcccagaggctggtgctaccgttccttgccttctgtctggcaag
aaacaatcggaggacgagctagatgagaaaccctttaaagagcctcttggtgcttccctt
acgatcagcatgaacagtgttccttcccctatcccctttgccagccccccgcaagcagat
ttccgcacagacatgggtttgccgccggatgagccgatacctgtggcagccctgccgtgc
ctgcatggagatggaagaatgcccctcgaggaatgcaaggcagaagtcaaatctgttttg
ctctcaccagaagtacccaccggtgcttctgttcttcctcctccaccaccaccttctgtt
cttcccaaaaggaggccaggtcggcccaggcggtcaccaccgtctgtcctctcgttggat
atgtactcgggcaaaaccatagaacctcctccggtgccagtggccttggtggaaagtgct
gtgggcaaagagctgttgagtggacatcctgatgctttctatggactgaaagaccctgaa
gccgtcaccctggacttcaggaatgacggtttccacgagaaaatagcagctgaagcagtt
gcggagaaactgccgtttaaggaactggagaaccagtggaatgaagacttcaaggaagaa
gaagctcatgcgaaacctaaaaggcagtggcgaaggcagaagaagacatctgaagacctc
ccagtgattccttcccctgagtattccccgccccagcctcagttcaagccacgctccgag
tttgaggagatgaccattttgtatgatatttggaacggaggcatagatgaggaggatatc
aaattcatgtgtatcacatatgaccgcttgttgcagcaggacaatggtatggactggctc
aatgacaccctgtgggtattccatccttctaccagcttttctactcctaagaaaaagaag
cgggatgatgggatgcgggagcacgtgacaggctgcgcacgaagtgaaggctattacaaa
attgataagaaggacaaacttaaatacctcaacaacagccgagcttttgcagaggagcct
ccagctgacacgcagggtatgagcatccctgcccaacctcatgcttccacccgggctggc
tccgagcggcggtcagagcagcgcaggcttctctcctccttcaccgggagctgcgacagt
gacctgctcaagttcaaccagctcaagttccggaagaaaaaactaaaattctgcaagagc
cacattcacgactggggtctttttgctatggagcccattgcagctgatgagatggtgatc
gagtacgtgggtcagaacatcaggcaggtcattgctgacatgcgtgaaaagcgatacgag
gatgaaggcattgggagcagctacatgttcagagtggatcacgacaccatcatcgatgcc
acaaaatgcggaaactttgccagatttattaatcacagctgcaatccaaattgttacgct
aaagtgatcacggtggagtctcaaaagaagatcgtcatctactccaaacagcacatcaac
gtgaatgaggaaattacctatgactacaagtttccgatcgaggatgtaaaaatcccatgt
ctgtgtggctctgagaactgcaggggaaccctgaactga

DBGET integrated database retrieval system